Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0C842
Symbols C10orf52

 GO Function (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MEGRNCTVEILPERLNIEGWYDADDTKPGKSWAGRAASIERLNEFDNNLFGISDLEAECLDPQQKLLLEC      1 - 70
TYGALESAGVPAKEVAGSRTGVFIGIMNQDYEFMSRRTPRMQTTVMPLDLQ                        71 - 121
//

Text Mined References (3)

PMID Year Title