Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0C842
Symbols C10orf52

Gene

 GO Function (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MEGRNCTVEILPERLNIEGWYDADDTKPGKSWAGRAASIERLNEFDNNLFGISDLEAECLDPQQKLLLEC      1 - 70
TYGALESAGVPAKEVAGSRTGVFIGIMNQDYEFMSRRTPRMQTTVMPLDLQ                        71 - 121
//

Text Mined References (3)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.