Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ependymoma 4679 1.4e-06

Expression

  Differential Expression (1)

Disease log2 FC p
ependymoma 1.200 1.4e-06

AA Sequence

MASGAGGSWGRSPPQSAVPTPWVTFLQPLSWAVPPAPPQPGRVKEDLLELMMLQNAQMHQLLLSRLVAGA      1 - 70
LQPRPASPCPQVYLEVPQEEPEEEEEEMDVREKGPLVFHHHYLPYLMPSPGALLPWPAPFFPTPACQPYL     71 - 140
QDVPRIQHCPASREREVRAVPPPPPPSATGTVGADVPPASDYYDAESLL                         141 - 189
//

Text Mined References (4)

PMID Year Title