Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0C7V0
Symbols C6orf217
NCRNA00271

Gene

 Compartment GO Term (0)

Gene RIF (4)

PMID Text
20580033 Observational study of gene-disease association. (HuGE Navigator)
20452750 There was no significant difference in brain expression of C6orf217 between patients and controls and no genotypic effect.
20452750 Observational study of gene-disease association. (HuGE Navigator)
17668382 Genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MLNSPGTRRPVKEAQKYGEDSQKSHSPGTPGPRSSVTTLSASALSDSSSPDTPPRRGPGRPSTPARAPAT      1 - 70
SAPMMYSRRGVRRTARPAGADTRSSANQLPQPSGACANADSAPPADVSACLRRRSHGDRCVPRSRRRPRP     71 - 140
RPRASTAFFQEEGPCGACPGALRPQAGASFRELRGLPPPRPREREQSPPLGAAPSSALSHQGWKNTRCAT    141 - 210
RGLVNTLVNTGHFLYLQPPAPLIMPYLDDAEVPGNRRSHPSLSFSWLSKALYHVTFLLRIL             211 - 271
//

Text Mined References (10)

PMID Year Title
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
20580033 2010 Replication of recently described type 2 diabetes gene variants in a South Indian population.
20452750 2010 Lymphoblast and brain expression of AHI1 and the novel primate-specific gene, C6orf217, in schizophrenia and bipolar disorder.
17668382 2007 Type 2 diabetes whole-genome association study in four populations: the DiaGen consortium.
17473831 2007 Support for involvement of the AHI1 locus in schizophrenia.
16773125 2006 AHI1, a pivotal neurodevelopmental gene, and C6orf217 are associated with susceptibility to schizophrenia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15169551 2004 Genome annotation of a 1.5 Mb region of human chromosome 6q23 encompassing a quantitative trait locus for fetal hemoglobin expression in adults.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.