Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
posterior fossa group B ependymoma 416 1.3e-09
pituitary cancer 1972 2.2e-05
Disease Target Count Z-score Confidence
Joubert syndrome 66 3.189 1.6

Expression

Gene RIF (4)

AA Sequence

MLNSPGTRRPVKEAQKYGEDSQKSHSPGTPGPRSSVTTLSASALSDSSSPDTPPRRGPGRPSTPARAPAT      1 - 70
SAPMMYSRRGVRRTARPAGADTRSSANQLPQPSGACANADSAPPADVSACLRRRSHGDRCVPRSRRRPRP     71 - 140
RPRASTAFFQEEGPCGACPGALRPQAGASFRELRGLPPPRPREREQSPPLGAAPSSALSHQGWKNTRCAT    141 - 210
RGLVNTLVNTGHFLYLQPPAPLIMPYLDDAEVPGNRRSHPSLSFSWLSKALYHVTFLLRIL             211 - 271
//

Text Mined References (11)

PMID Year Title