Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.50
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P0C7U1 B7Z261
Symbols ASAH2C
ASAH2L
bA98I6.3
bA449O16.3

Gene

 Compartment GO Term (1)

AA Sequence

MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSV      1 - 70
QNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNR     71 - 140
KQDILKPAVILSFEGTSPAFEVVTI                                                 141 - 165
//

Text Mined References (5)

PMID Year Title
17334805 2007 A novel gene derived from a segmental duplication shows perturbed expression in Alzheimer's disease.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.