Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.100 0.026
osteosarcoma 2.399 0.003
ovarian cancer -1.100 0.002

Synonym

Accession P0C7T7
Symbols C14orf82

Gene

 Compartment GO Term (0)

AA Sequence

MQLGRSGRRSQKQKHEVDEVYFTLTRVDRSCPYLTVPGPPGAESGAPVRLGLRQRAVSSSRNPNSAGRTP      1 - 70
NSYLTQAPVWRRSAPAQPPAPQTRHFPGRGADPALGSLPAAGLSGLCARTTGGTAQPPGARDSGASPGAQ     71 - 140
PQRHRPGCRGPPGSPVIRGPPRCREPGTAHGAQTPPPTRPNWPRRQPSRGSCALSSRQYGERPPAPPWTQ    141 - 210
PSVPRRGAATWGQEKAEYATPLGTQEARRASGGRGGVDHGDQGLSPCCGDGGARGRRRLPTFWPSGLLRL    211 - 280
RLDSLGALPPEPSRAGRGRLFGLSVVLLKRNAGGEATPREGGPRRRWLRESCSPLPARHSRRRASWVSRW    281 - 350
MEGAPPRMPSLPL                                                             351 - 363
//

Text Mined References (3)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
11181995 2001 The sequence of the human genome.