Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MAGSHPYFNLPDSTHPSPPSTPPSLHWHQRCQPSDATNGLLVALLGGGLPAGFVGPLSRMAYQASNLPSL      1 - 70
ELVICRCLFHLPIALLLKLRGDPLLGPPDIRGRTCFCALLNVLNIGCAYSAVQVVPTGNAATVRKHSSTV     71 - 140
CSAILTLCLESQVLSGYDWCGLLGSILGLIIIVGPGLWTLQEGTTGVYTGLGYVQAFLGGLALSLGLLVY    141 - 210
RSLHFPSCLPTVAFLSGLVGLLGSVPGLFVLQSPVLPSDLLSWSCVGAVGILTLVSFTCVGYAVTKAHPA    211 - 280
LVCAVLHSEVVMALILQYFMLHETVAPSDIMGAGVVLGSIAIITARNLICERTGKVEE                281 - 338
//

Text Mined References (2)

PMID Year Title
17101974 2006 Emergence of primate genes by retrotransposon-mediated sequence transduction.
16177791 2005 DNA sequence and analysis of human chromosome 18.