Property Summary

NCBI Gene PubMed Count 2
PubMed Score 231.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

 GO Component (1)

AA Sequence

MQQIYTVKEIRSVAARSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAVR      1 - 70
RPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESTEARKGFSYLVTGVTTVGVAYAAKN     71 - 140
AVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIKQEAAVELSQLRDPQHD    141 - 210
LDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPATLNLEVPTYEFTSDDMV    211 - 280
IVG                                                                       281 - 283
//

Text Mined References (3)

PMID Year Title