Property Summary

NCBI Gene PubMed Count 2
Grant Count 400
R01 Count 149
Funding $91,911,819.54
PubMed Score 224.94

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession P0C7P4
Symbols UQCRFSL1

Gene

 GO Component (1)

AA Sequence

MQQIYTVKEIRSVAARSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAVR      1 - 70
RPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESTEARKGFSYLVTGVTTVGVAYAAKN     71 - 140
AVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIKQEAAVELSQLRDPQHD    141 - 210
LDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPATLNLEVPTYEFTSDDMV    211 - 280
IVG                                                                       281 - 283
//

Text Mined References (3)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
10591208 1999 The DNA sequence of human chromosome 22.
8088805 1994 Assignment of the gene (UQCRFS1) for the Rieske iron-sulfur protein subunit of the mitochondrial cytochrome bc1 complex to the 22q13 and 19q12-q13.1 regions of the human genome.