Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.72

Knowledge Summary

Patent

No data available

AA Sequence

MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNG      1 - 70
KSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTRGWLPSQEGHLDDGGYTPDLK     71 - 140
MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRRENYGVPPRRATISSWRNDRMST    141 - 210
RHDGYATNDGNHPSCQETRDYAPPSRGYAYRDNGHSNRDEHSSRGYRNHRSSRETRDYAPPSRGHAYRDY    211 - 280
GHSRRDESYSRGYRNRRSSRETREYAPPSRGHGYRDYGHSRRHESYSRGYRNHPSSRETRDYAPPHRDYA    281 - 350
YRDYGHSSWDEHSSRGYSYHDGYGEALGRDHSEHLSGSSYRDALQRYGTSHGAPPARGPRMSYGGSTCHA    351 - 420
YSNTRDRYGRSWESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPDPREACGSSSYVASIVDGGESRSEK    421 - 490
GDSSRY                                                                    491 - 496
//

Text Mined References (7)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15184870 2004 RBMY, a male germ cell-specific RNA-binding protein, activated in human liver cancers and transforms rodent fibroblasts.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9598316 1998 Structure and organization of the RBMY genes on the human Y chromosome: transposition and amplification of an ancestral autosomal hnRNPG gene.
8875892 1996 Degeneracy in human multicopy RBM (YRRM), a candidate spermatogenesis gene.
8269511 1993 A Y chromosome gene family with RNA-binding protein homology: candidates for the azoospermia factor AZF controlling human spermatogenesis.