Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.84
PubTator Score 0.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.22126082552709E-8
tuberculosis 1563 1.19736012812982E-5
ulcerative colitis 2087 1.75539201065535E-5

Synonym

Accession P0C7P0
Symbols Miner2

Gene

  Ortholog (5)

Species Source
Mouse OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Xenopus OMA Inparanoid

AA Sequence

MRGAGAILRPAARGARDLNPRRDISSWLAQWFPRTPARSVVALKTPIKVELVAGKTYRWCVCGRSKKQPF      1 - 70
CDGSHFFQRTGLSPLKFKAQETRMVALCTCKATQRPPYCDGTHRSERVQKAEVGSPL                  71 - 127
//

Text Mined References (7)

PMID Year Title
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17584744 2007 The outer mitochondrial membrane protein mitoNEET contains a novel redox-active 2Fe-2S cluster.
17376863 2007 MitoNEET is an iron-containing outer mitochondrial membrane protein that regulates oxidative capacity.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.