Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.02
PubTator Score 0.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.2e-08
tuberculosis 2010 1.2e-05
ulcerative colitis 1819 1.8e-05
Disease Target Count Z-score Confidence
Wolfram syndrome 12 3.503 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.852 1.2e-08
tuberculosis 1.100 1.2e-05
ulcerative colitis -1.100 1.8e-05

AA Sequence

MRGAGAILRPAARGARDLNPRRDISSWLAQWFPRTPARSVVALKTPIKVELVAGKTYRWCVCGRSKKQPF      1 - 70
CDGSHFFQRTGLSPLKFKAQETRMVALCTCKATQRPPYCDGTHRSERVQKAEVGSPL                  71 - 127
//

Text Mined References (7)

PMID Year Title