Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.31
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Oligospermia 36 4.829 2.4
Azoospermia 110 3.664 1.8

AA Sequence

MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEE      1 - 70
KDGGGEEKDGGGAGVPGHLWEGNLEGTSGSDGNVEDSDQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHA     71 - 140
FTPLQLQELECIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQRALMARNMLPFMAVGQP    141 - 210
VMVTAAEAITAPLFISGMRDDYFWDHSHSSSLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIV    211 - 280
PSFTFPNV                                                                  281 - 288
//

Text Mined References (2)

PMID Year Title