Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MRQNNNITEFVLLGFSQYPDVQNALFVMFLLIYIVTMVGNLLIVVSIIASPFLGSPVYFFLACLSFIDAV      1 - 70
YSTTISPVLIVDLLCDKKTISFPACMGQLFIEHLFGDTDVFLLVVMAYDRYVATCKPLRYLTIMNRQVCI     71 - 140
LLLVVAVTGGFLHSVFQILVVYSLPFCGPNVIYHFFCNIYPLLDLECTDTYFVGLAVVFNGGAICMVIFT    141 - 210
LLLISYGVILNSLKTYSPEGRHKAPFICSSHFIMVILFFVPCIFLYVRPVSNFPIDKFLTVFYSVITPKL    211 - 280
NPFIYMLRNSEMRNAIENLLGYQSGKTGFRCSKLN                                       281 - 315
//

Text Mined References (4)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14983052 2004 The human olfactory receptor gene family.
12730696 2003 Different noses for different people.
12644552 2003 Population differences in the human functional olfactory repertoire.