Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.13
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0C5Z0 A1L4E4 P98176 Q5TZB2 Q6FG78 Q96PR7
Symbols H2AFB
H2ABBD

Gene

 GO Function (1)

Gene RIF (5)

PMID Text
24584930 data suggest that H2ABbd may contribute to specific chromatin structures and promote NF-kappaB activation, which could in turn induce apoptosis in mammalian cells
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLEL      1 - 70
AGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED                              71 - 115
//

Text Mined References (16)

PMID Year Title
25731851 2015 Nucleosome adaptability conferred by sequence and structural variations in histone H2A-H2B dimers.
24584930 2014 Mammal-specific H2A variant, H2ABbd, is involved in apoptotic induction via activation of NF-?B signaling pathway.
22795134 2012 Histone variant H2A.Bbd is associated with active transcription and mRNA processing in human cells.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20008104 2010 H2A.Bbd: an X-chromosome-encoded histone involved in mammalian spermiogenesis.
18329190 2008 Quickly evolving histones, nucleosome stability and chromatin folding: all about histone H2A.Bbd.
17726088 2008 H2A.Bbd: a quickly evolving hypervariable mammalian histone that destabilizes nucleosomes in an acetylation-independent way.
17591702 2007 ATP-dependent chromatin remodeling is required for base excision repair in conventional but not in variant H2A.Bbd nucleosomes.
16957777 2006 Dissection of the unusual structural and functional properties of the variant H2A.Bbd nucleosome.
16287874 2005 Assembly and disassembly of nucleosome core particles containing histone variants by human nucleosome assembly protein I.
More...