Property Summary

NCBI Gene PubMed Count 8
PubMed Score 10.01
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Protein-protein Interaction (11)

AA Sequence

MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVPEL      1 - 70
AGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED                              71 - 115
//

Text Mined References (19)

PMID Year Title