Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0C2Y1
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MCLRFFSPVPGSTSSATNVTMVVSAGPWSSEKAEMNILEINEKLRPQLAENKQQFRNMKQKFLVTQMAGF      1 - 70
LANQQNKYKYEECKDLIKSMLREELQFKEEKLAEQLKQAEELRQYKVLVHSQERELIQLREKLREGRDAS     71 - 140
HSLNQHLQALLTPDKHDNSQGQDFREQLAEGCRLARHLVHKLSPENDTDEDENDKTKELDKVQESPAPRE    141 - 210
EQKAEEKEVPEDSLEECAITYSNSHGPSDSNPPHKNIKITSEEDKVNSILVVDSESSQDEWQDALNILLE    211 - 280
NQNDDEEEEGKAPVPPQVTLWICGLKLQESEEKEVLQDSPEERVTTSCSDHDVSQSYQPCEGTFLALVEQ    281 - 350
KVCSAQDVASEHSNSKGEETPLGFPDTKYCWKDEKDERMSQKVAFLLDEKNYNSKPSSIPNTTLQGSFTE    351 - 420
D//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16079250 2005 A novel gene family NBPF: intricate structure generated by gene duplications during primate evolution.