Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P0C221 G3V5J7
Symbols C14orf38
c14_5395

Gene

 Compartment GO Term (1)

AA Sequence

MALSPWTPGLGAGEKLVQAAAVSTGPSLELCTLPSTLGSSVAVEALEQLFVVEQSLQSDYFKCNEEAKIF      1 - 70
LKDIAVAVKKLEEMRKATIDLLEIESMELNKLYYLLETLPNSIKRELEECVRDARRLNLFEINTIKMRIT     71 - 140
RTENEIELLKKKITDLTKYNEALGEKQEELARKHARFVLSLNQTMEKKATTTVYINETYTKINLKREDIA    141 - 210
LQKKCIQEAEELMEKERAEYLIRKQELTAQINEFENTREVKRMETYQKKKELDKLQTKMSKIKETVTVSA    211 - 280
AVLSDHNLEIARLHESIRYWEQEVSELKKDLAILEAKLCFFTDNKEKLDDISNDEKNEFLNKIKQLVETL    281 - 350
HAARMEYKDLREKMKTLARQYKIVLSEEEKAFLQKQKIHDENQKQLTFISQKEYFLSQKRVDIKNMEEGL    351 - 420
ITLQELQQATKTVYQQQIKILSANLERESQRCVITQWKMACLRKKHARWTAKIKAEIQAITEKIQNAEVR    421 - 490
RIELLNETSFRQQEISGFVAQIEKLTTELKEEEKAFVNKEKMLMKELSKYEEIFVKETQINKEKEEELVE    491 - 560
YLPQLQVAEQEYKEKRRKLEELSNIITAQRQEEDLLNNHIFLFTRDFSRYISNMEDVKQELQQLRDQESK    561 - 630
KNKDHFETLKNLENGFYINDQKADLLLLENKKLKEYILYLKNNIEKYREGQEALMHTSSDLSRQLIAQEA    631 - 700
QYKDLWAEFQTTVKILVDNGEETLQDINNLTDKLRERDEKMQHVSTWLRGSLEGLRLLVEQESPMDLLKK    701 - 770
KKHIRTRVHFPVVKCTEKNTLTK                                                   771 - 793
//

Text Mined References (2)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
12508121 2003 The DNA sequence and analysis of human chromosome 14.