Property Summary

Ligand Count 3
NCBI Gene PubMed Count 50
PubMed Score 200.79
PubTator Score 162.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
HYPERPHENYLALANINEMIA, BH4-DEFICIENT, C 1 0.0 0.0
Phenylketonurias 2 0.0 0.0

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.400 1.3e-03
astrocytic glioma -1.500 4.0e-02
atypical teratoid / rhabdoid tumor -2.000 1.9e-06
ependymoma -2.200 3.1e-02
glioblastoma -1.100 2.5e-03
group 3 medulloblastoma -1.200 5.0e-03
lung cancer 1.400 6.4e-03
lung carcinoma 1.400 2.8e-18
malignant mesothelioma -2.900 2.4e-08
medulloblastoma, large-cell -2.100 3.1e-07
nasopharyngeal carcinoma 1.100 6.4e-04
oligodendroglioma -1.200 1.0e-10
ovarian cancer 1.300 6.5e-03
primitive neuroectodermal tumor -1.200 6.4e-05
subependymal giant cell astrocytoma -2.376 3.8e-03
tuberculosis 1.300 4.1e-07

Gene RIF (15)

AA Sequence

MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAE      1 - 70
VGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAA     71 - 140
LDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVE    141 - 210
TFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF                                        211 - 244
//

Text Mined References (57)

PMID Year Title