Property Summary

NCBI Gene PubMed Count 21
Grant Count 10
R01 Count 7
Funding $517,610.3
PubMed Score 45.65
PubTator Score 24.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (7)

PMID Text
26545093 identified heterozygous HOXD4 loss-of-function mutations in three subjects with spinal extradural arachnoid cyst (SEDAC)
20686522 The results suggest that genetic polymorphisms in HOXD4 may not be a major contributor to the observed variability in peak BMD in the lumbar spine and the hip in Chinese men and women
20686522 Observational study of gene-disease association. (HuGE Navigator)
19938081 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19232136 microRNA-10a (miR-10a) targets a homologous DNA region in the promoter region of the hoxd4 gene and represses its expression at the transcriptional level
15776434 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPG      1 - 70
SALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQPPSGTALKQPAVVYPWMKKV     71 - 140
HVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWK    141 - 210
KDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL                             211 - 255
//

Text Mined References (22)

PMID Year Title
26545093 2015 Identification of HOXD4 Mutations in Spinal Extradural Arachnoid Cyst.
20686522 2010 Polymorphisms in the HOXD4 gene are not associated with peak bone mineral density in Chinese nuclear families.
19938081 2009 Altered transmission of HOX and apoptotic SNPs identify a potential common pathway for clubfoot.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19232136 2009 Transcriptional inhibiton of Hoxd4 expression by miRNA-10a in human breast cancer cells.
15776434 2005 Mutation analysis of the HOX paralogous 4-13 genes in children with acute lymphoid malignancies: identification of a novel germline mutation of HOXD4 leading to a partial loss-of-function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
More...