Property Summary

NCBI Gene PubMed Count 22
PubMed Score 47.59
PubTator Score 24.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Precursor Cell Lymphoblastic Leukemia-Lymphoma 49 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Embryonal carcinoma 10 4.437 2.2

Expression

Gene RIF (7)

AA Sequence

MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPG      1 - 70
SALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQPPSGTALKQPAVVYPWMKKV     71 - 140
HVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWK    141 - 210
KDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL                             211 - 255
//

Text Mined References (23)

PMID Year Title