Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
R01 Count 1
Funding $65,543.8
PubMed Score 6.90
PubTator Score 10.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.264 0.008
psoriasis 2.300 0.000
osteosarcoma 1.898 0.000
non-small cell lung cancer 1.379 0.000
lung cancer 2.600 0.000
Breast cancer 3.400 0.047
nasopharyngeal carcinoma 1.100 0.000
lung adenocarcinoma 1.090 0.000
ovarian cancer 2.300 0.005

Synonym

Accession P09001 Q6IBT2 L3mt
Symbols MRL3
RPML3
COXPD9

Gene

 Grant Application (1)

PDB

3J9M   3J7Y  

Gene RIF (3)

PMID Text
22507240 Found MRPL3 S75N variant is probably a rare cause of Tourette syndrome/chronic tic phenotype in Chinese Han patients.
21786366 the first mutation in large mitochondrial ribosomal protein MRPL3 in a family of four sibs with hypertrophic cardiomyopathy, psychomotor retardation, and multiple respiratory chain deficiency.(MRPL3)
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPGWRLLTQVGAQVLGRLGDGLGAALGPGNRTHIWLFVRGLHGKSGTWWDEHLSEENVPFIKQLVSDEDK      1 - 70
AQLASKLCPLKDEPWPIHPWEPGSFRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNG     71 - 140
KMATLSVGGKTVSRFRKATSILEFYRELGLPPKQTVKIFNITDNAAIKPGTPLYAAHFRPGQYVDVTAKT    141 - 210
IGKGFQGVMKRWGFKGQPATHGQTKTHRRPGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKH    211 - 280
NIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPGAPSITFA      281 - 348
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22507240 2012 Analysis of the MRPL3, DNAJC13 and OFCC1 variants in Chinese Han patients with TS-CTD.
21786366 2011 Exome sequencing identifies MRPL3 mutation in mitochondrial cardiomyopathy.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20186120 2010 A functional peptidyl-tRNA hydrolase, ICT1, has been recruited into the human mitochondrial ribosome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...