Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.90
PubTator Score 10.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 3.400 4.7e-02
lung adenocarcinoma 1.090 3.2e-09
lung cancer 2.600 3.4e-04
Multiple myeloma 1.264 8.1e-03
nasopharyngeal carcinoma 1.100 3.2e-05
non-small cell lung cancer 1.379 2.2e-12
osteosarcoma 1.898 2.0e-04
ovarian cancer 2.300 4.6e-03
psoriasis 2.300 3.1e-05

Gene RIF (3)

AA Sequence

MPGWRLLTQVGAQVLGRLGDGLGAALGPGNRTHIWLFVRGLHGKSGTWWDEHLSEENVPFIKQLVSDEDK      1 - 70
AQLASKLCPLKDEPWPIHPWEPGSFRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNG     71 - 140
KMATLSVGGKTVSRFRKATSILEFYRELGLPPKQTVKIFNITDNAAIKPGTPLYAAHFRPGQYVDVTAKT    141 - 210
IGKGFQGVMKRWGFKGQPATHGQTKTHRRPGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKH    211 - 280
NIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPGAPSITFA      281 - 348
//

Text Mined References (16)

PMID Year Title