Property Summary

NCBI Gene PubMed Count 29
Grant Count 8
R01 Count 8
Funding $1,975,383.8
PubMed Score 368.05
PubTator Score 162.30

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
26817104 The results of the study suggest that the levels of apelin, TNF-alpha and elastase-1 are important diagnostic markers of CP in patients with type 2 diabetes mellitus.
24684771 Recombinant type I pancreatic elastase improves unassisted arteriovenous fistula maturation in hemodialysis patients.
22749648 A low value of faecal elastase-1, indicating reduced exocrine pancrease secretion, is strongly correlated with a poor survival in advanced pancreatic cancer.
22094930 FE-1 is a poor surrogate for diagnosing impaired fat absorption.
20428826 Hypermethylation of ELA3B gene promoter were associated with pancreatic cancer.
19073396 Parathormone levels and Vitamin D metabolism in female patients with various grades of fecal ELA1 deficiency are reported.
18424365 Reduced fecal elastase 1 connected with lowered serum levels of vitamin D3 is associated with osteoporotic bone fractures.
18362841 Neither low fecal elastase 1 nor raised fecal fat levels reliably indicate exocrine pancreatic insufficiency in type-1 diabetes.
17989309 Fecal fat excretion is increased in patients with type 2 diabetes with fecal elastase deficiency.
17103488 Patients with type 1 diabetes and low fecal elastase 1 concentrations were succesfully treatted with pancretin.
More...

AA Sequence

MMLRLLSSLLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVT      1 - 70
AGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQ     71 - 140
LASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIR    141 - 210
SGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH              211 - 270
//

Text Mined References (30)

PMID Year Title
26817104 2015 [DIAGNOSTIC MARKERS FOR CHRONIC PANCREATITIS IN PATIENTS WITH TYPE 2 DIABETES MELLITUS WITH DIFFERENT PHENOTYPE].
24684771 2014 Human type I pancreatic elastase treatment of arteriovenous fistulas in patients with chronic kidney disease.
22749648 2012 Faecal elastase-1 is an independent predictor of survival in advanced pancreatic cancer.
22094930 2011 Partial pancreatic resection for pancreatic malignancy is associated with sustained pancreatic exocrine failure and reduced quality of life: a prospective study.
20428826 2010 Identification of pancreatic juice proteins as biomarkers of pancreatic cancer.
19073396 2008 Parathormone levels and Vitamin D metabolism in female patients with various grades of fecal elastase 1 deficiency.
18424365 2008 Fecal elastase 1 and vitamin D3 in patients with osteoporotic bone fractures.
18362841 2008 Low fecal elastase 1 levels do not indicate exocrine pancreatic insufficiency in type-1 diabetes mellitus.
17989309 2008 Pancreatic exocrine dysfunction in maturity-onset diabetes of the young type 3.
17103488 2007 Pancreatin therapy in patients with insulin-treated diabetes mellitus and exocrine pancreatic insufficiency according to low fecal elastase 1 concentrations. Results of a prospective multi-centre trial.
More...