Property Summary

NCBI Gene PubMed Count 32
PubMed Score 385.88
PubTator Score 162.30

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

AA Sequence

MMLRLLSSLLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVT      1 - 70
AGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQ     71 - 140
LASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIR    141 - 210
SGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH              211 - 270
//

Text Mined References (33)

PMID Year Title