Property Summary

NCBI Gene PubMed Count 42
PubMed Score 0.00
PubTator Score 39.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.200 0.000
lung cancer -4.000 0.022
ovarian cancer -1.100 0.001

Synonym

Accession P08708 B2R4U4 P0CW22
Symbols S17
DBA4
RPS17L
RPS17L1
RPS17L2

Gene

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX  

Gene RIF (8)

PMID Text
25853866 Nuclear and nucleolar localization signals within the human ribosomal protein S17 have been mapped.
22944692 HIV-1 Rev interacting protein, ribosomal protein S17 (RPS17), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22398290 Human S17 insertion was a major factor for hepatitis E virus in cell culture adaptation.
22262766 Data show 1 proband with an RPL5 deletion, 1 patient with an RPL35A deletion, 3 with RPS17 deletions, and 1 with an RPS19 deletion.
22174317 HIV-1 Rev interacting protein, ribosomal protein S17 (RPS17), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22045982 Studies identified deletions at known Diamond-Blackfan anemia (DBA)-related ribosomal protein gene loci in 17% (9 of 51) of patients without an identifiable mutation, including RPS19, RPS17, RPS26, and RPL35A.
20378560 Observational study of gene-disease association. (HuGE Navigator)
17647292 Data show in Diamond-Blackfan anemia, mutation in RPS17 wasn detected and the mutation affects the translation initiation start codon, changing T to G (c.2T>G), thus eliminating the natural start of RPS17 protein biosynthesis

AA Sequence

MGRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGIS      1 - 70
IKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGPV          71 - 135
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25853866 2015 Identification and fine mapping of nuclear and nucleolar localization signals within the human ribosomal protein S17.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24675553 2014 Ribosomal protein mutations in Korean patients with Diamond-Blackfan anemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...