Property Summary

NCBI Gene PubMed Count 43
PubMed Score 0.00
PubTator Score 39.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.300 2.9e-04
medulloblastoma, large-cell 1.200 2.3e-06
ovarian cancer -1.100 1.0e-03

Gene RIF (8)

AA Sequence

MGRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGIS      1 - 70
IKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGPV          71 - 135
//

Text Mined References (49)

PMID Year Title