Property Summary

NCBI Gene PubMed Count 38
Grant Count 222
R01 Count 78
Funding $63,949,871.24
PubMed Score 343.04
PubTator Score 213.58

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P08651 A8K1H0 B7Z4U5 B7Z9C3 K7EMU1 P08652 Q14932 Q9UPJ3 Q9UPJ9 Q9UPK0 Q9UPK1 NF1-C
Symbols CTF
NFI
CTF5
NF-I

Gene

PANTHER Protein Class (1)

Gene RIF (22)

PMID Text
25879941 Nuclear factor I-C regulates E-cadherin via control of KLF4 in breast cancer
25668322 Over-expression of NFIC increased cell proliferation, mineralization nodule formation and alkaline phosphatase activity in stem cells from the apical papilla.
25220407 TGF-beta-mediated suppression of ANT2 through NF1/Smad4 complexes contributes to oxidative stress and DNA damage during induction of cellular senescence.
24801901 Results suggest that NFI-C acts as a transcriptional switch in cell fate determination between osteoblast and adipocyte differentiation in BMSCs.
23839947 These data suggest a critical role for calcineurin in NFI transcriptional regulation and in the determination of malignant glioma infiltrative properties.
23208493 transcription factor Nuclear Factor 1-C (NF1C) as a candidate to regulate AHR transcription in a polymorphism-dependent manner
22420942 the influence of i3T3 on the expression and DNA binding of NFI, another TF important for cell proliferation and cell cycle progression
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20145151 novel role of NF1-C2 in tumor development and epithelial-to-mesenchymal transition in breast cancer; NF1-C2 is lost during tumor progression and virtully absent from lymph node metastases; FoxF1 was was found to be a direct repressed target of NF1-C2
19755487 A specific region (-688 to -611 bp) was discovered in the IRS2 promoter essential for basal promoter activity and oxidative stress induced transcription depending on ERK activation and SP1 and NFI binding in human hepatocytes.
More...

AA Sequence

MYSSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKPEVKQ      1 - 70
KWASRLLAKLRKDIRPECREDFVLSITGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKG     71 - 140
IPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSGSPRTGMGSDQEDSKPIT    141 - 210
LDTTDFQESFVTSGVFSVTELIQVSRTPVVTGTGPNFSLGELQGHLAYDLNPASTGLRRTLPSTSSSGSK    211 - 280
RHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPSPQDSPRLSSFT    281 - 350
QHHRPVIAVHSGIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQ    351 - 420
PGPLNGSGQLKMPSHCLSAQMLAPPPPGLPRLALPPATKPATTSEGGATSPTSPSYSPPDTSPANRSFVG    421 - 490
LGPRDPAGIYQAQSWYLG                                                        491 - 508
//

Text Mined References (47)

PMID Year Title
25879941 2015 Nuclear factor I-C regulates E-cadherin via control of KLF4 in breast cancer.
25668322 2015 Nuclear Factor I-C promotes proliferation and differentiation of apical papilla-derived human stem cells in vitro.
25220407 2014 TGF-?/NF1/Smad4-mediated suppression of ANT2 contributes to oxidative stress in cellular senescence.
24801901 2014 NFI-C regulates osteoblast differentiation via control of osterix expression.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23839947 2013 Calcineurin regulates nuclear factor I dephosphorylation and activity in malignant glioma cell lines.
23208493 2013 Inhibition of AHR transcription by NF1C is affected by a single-nucleotide polymorphism, and is involved in suppression of human uterine endometrial cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...