Property Summary

NCBI Gene PubMed Count 40
PubMed Score 358.21
PubTator Score 213.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

 GO Component (2)

Gene RIF (24)

AA Sequence

MYSSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKPEVKQ      1 - 70
KWASRLLAKLRKDIRPECREDFVLSITGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKG     71 - 140
IPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSGSPRTGMGSDQEDSKPIT    141 - 210
LDTTDFQESFVTSGVFSVTELIQVSRTPVVTGTGPNFSLGELQGHLAYDLNPASTGLRRTLPSTSSSGSK    211 - 280
RHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPSPQDSPRLSSFT    281 - 350
QHHRPVIAVHSGIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQ    351 - 420
PGPLNGSGQLKMPSHCLSAQMLAPPPPGLPRLALPPATKPATTSEGGATSPTSPSYSPPDTSPANRSFVG    421 - 490
LGPRDPAGIYQAQSWYLG                                                        491 - 508
//

Text Mined References (49)

PMID Year Title