Property Summary

NCBI Gene PubMed Count 80
PubMed Score 426.45
PubTator Score 347.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.400 0.033
ependymoma 1.300 0.024
psoriasis -1.800 0.001
osteosarcoma 1.070 0.000
pancreatic ductal adenocarcinoma liver m... 1.729 0.001
spina bifida 1.312 0.046
Pick disease -1.600 0.000
progressive supranuclear palsy -1.100 0.005
ovarian cancer 1.900 0.000

Synonym

Accession P08621 B3KUA3 P78493 P78494 Q15364 Q15686 Q15687 Q15689 Q99377 Q9UE45 Q9UE46 Q9UE47 Q9UE48 Q9UFQ6 U1 snRNP 70 kDa
Symbols RPU1
Snp1
U1AP
U170K
U1RNP
RNPU1Z
SNRP70
U1-70K

Gene

PDB

3CW1   3PGW   4PJO   2L5I   2L5J   4PKD  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
C. elegans EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (28)

PMID Text
26828962 The authors propose that Gemin2 is a versatile hub for ribonucleoprotein exchange that functions broadly in RNA metabolism.
26333287 The epitopes of U1-70K autoantibodies have been mapped at single-amino acid resolution.
26124092 data lead to a model that FUS functions in coupling transcription to splicing via mediating an interaction between RNAP II and U1 snRNP
25795785 methylation of snRNP70 by SETMAR regulates constitutive and/or alternative splicing
25555158 The selection of 5'-splice site nucleotides by U1 snRNP is achieved predominantly through basepairing with U1 snRNA whilst U1-C fine-tunes relative affinities of mismatched 5'-splice sites.
25355317 Data indicate that small nuclear ribonucleoprotein U1-70K in Alzheimer disease (AD) may directly sequester normal soluble forms of U1-70K into insoluble aggregates.
25052091 U1-70K interacts with the SMN complex and is required for nuclear gem integrity.
24773620 These studies identify U1 snRNP pathologic changes in brain of early onset genetic forms of Alzheimer's disease
24461387 [review] The presence of antibodies against U1snRNP autoantigen is considered the serological hallmark of mixed connective tissue disease (MCTD), which is characterized by overlapping features between at least two systemic autoimmune diseases.
24023061 Our results demonstrate unique U1 snRNP pathology and implicate abnormal RNA splicing in Alzheimer's disease pathogenesis.
More...

AA Sequence

MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK      1 - 70
RREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS     71 - 140
GKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRH    141 - 210
SGRDDTSRYDERPGPSPLPHRDRDRDRERERRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRER    211 - 280
SKDKDRDRKRRSSRSRERARRERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDR    281 - 350
DRERRRSHRSERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGG    351 - 420
DGYLAPENGYLMEAAPE                                                         421 - 437
//

Text Mined References (95)

PMID Year Title
26828962 2016 A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26333287 2015 Mapping epitopes of U1-70K autoantibodies at single-amino acid resolution.
26124092 2015 FUS functions in coupling transcription to splicing by mediating an interaction between RNAP II and U1 snRNP.
25795785 2015 A Proteomic Strategy Identifies Lysine Methylation of Splicing Factor snRNP70 by the SETMAR Enzyme.
25719862 2015 Modulation of deregulated chaperone-mediated autophagy by a phosphopeptide.
25555158 2015 Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
25355317 2014 Aggregation properties of the small nuclear ribonucleoprotein U1-70K in Alzheimer disease.
25052091 2014 The splicing factor U1-70K interacts with the SMN complex and is required for nuclear gem integrity.
24773620 2014 U1 small nuclear ribonucleoproteins (snRNPs) aggregate in Alzheimer's disease due to autosomal dominant genetic mutations and trisomy 21.
More...