Property Summary

NCBI Gene PubMed Count 83
PubMed Score 440.92
PubTator Score 347.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.300 1.4e-02
ependymoma 1.200 1.1e-02
osteosarcoma 1.070 4.6e-04
ovarian cancer 1.900 1.0e-07
pancreatic ductal adenocarcinoma liver m... 1.729 9.3e-04
Pick disease -1.600 4.1e-05
progressive supranuclear palsy -1.100 4.8e-03
psoriasis -1.800 9.7e-04
spina bifida 1.312 4.6e-02

Gene RIF (29)

AA Sequence

MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK      1 - 70
RREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS     71 - 140
GKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRH    141 - 210
SGRDDTSRYDERPGPSPLPHRDRDRDRERERRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRER    211 - 280
SKDKDRDRKRRSSRSRERARRERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDR    281 - 350
DRERRRSHRSERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGG    351 - 420
DGYLAPENGYLMEAAPE                                                         421 - 437
//

Text Mined References (100)

PMID Year Title