Property Summary

NCBI Gene PubMed Count 52
Grant Count 241
R01 Count 94
Funding $59,839,879.17
PubMed Score 380.97
PubTator Score 252.76

Knowledge Summary

Patent

No data available

Synonym

Accession P08620 B7U994 FGF-4
Symbols HST
KFGF
HST-1
HSTF1
K-FGF
HBGF-4

Gene

PANTHER Protein Class (2)

PDB

1IJT  

Gene RIF (25)

PMID Text
26828265 Thus, we conclude that the oncoprotein HBXIP up-regulates FGF4 through activating transcriptional factor Sp1 to promote the migration of breast cancer cells. Therapeutically, HBXIP may serve as a novel target in breast cancer.
25329002 Fibroblasts induce expression of FGF4 in ovarian cancer stem-like cells/cancer-initiating cells and upregulate their tumor initiation capacity.
24120895 A de novo 290 kb interstitial duplication of chromosome 11q13.3 including the FGF3 and FGF4 genes.
23939864 Data show that the interaction between Artd1 and Sox2 is crucial for the first steps of the reprogramming process and that early expression of Fgf4 is an essential component for the successful generation of iPSCs.
22237711 In vivo stimulation of BT-474 cell growth by progesterone is associated with up-regulation of FGF4 which may promote tumor growth and maintenance.
21673370 Myoblasts which overexpress FGF-4 exhibit significant changes in cell cycle and pro-angiogenic potential with only slight differences in the expression of the myogenic genes.
21567388 knockdown of FGFR4 expression led to decreased proliferation and an increased rate of apoptosis in the MKN45 and SGC7901 GC cell lines
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20864512 Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQ      1 - 70
SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMS     71 - 140
SKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL        141 - 206
//

Text Mined References (53)

PMID Year Title
26828265 2016 The oncoprotein HBXIP up-regulates FGF4 through activating transcriptional factor Sp1 to promote the migration of breast cancer cells.
25329002 2014 Fibroblasts induce expression of FGF4 in ovarian cancer stem-like cells/cancer-initiating cells and upregulate their tumor initiation capacity.
24120895 2014 Increased FGF3 and FGF4 gene dosage is a risk factor for craniosynostosis.
23939864 2013 Artd1/Parp1 regulates reprogramming by transcriptional regulation of Fgf4 via Sox2 ADP-ribosylation.
22237711 2012 Differential expression of FGF family members in a progestin-dependent BT-474 human breast cancer xenograft model.
21673370 2011 Transient and stable transfections of mouse myoblasts with genes coding for pro-angiogenic factors.
21567388 2011 Fibroblast growth factor receptor 4 regulates proliferation and antiapoptosis during gastric cancer progression.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20864512 2010 A panel of sputum-based genomic marker for early detection of lung cancer.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
More...