Property Summary

NCBI Gene PubMed Count 52
PubMed Score 394.05
PubTator Score 252.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Carcinoma, Hepatocellular 228 0.0 0.0
Disease Target Count
Liver carcinoma 240
Mammary Neoplasms 425
Disease Target Count P-value
lung cancer 4740 4.6e-08
osteosarcoma 7950 2.9e-07
psoriasis 6694 1.0e-04
diabetes mellitus 1728 4.6e-03
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 109 0.0 1.2
Disease Target Count Z-score Confidence
Cancer 2499 4.061 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus 1.300 4.6e-03
lung cancer 5.700 4.6e-08
osteosarcoma 1.346 2.9e-07
psoriasis 1.500 1.0e-04

Gene RIF (25)

AA Sequence

MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQ      1 - 70
SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMS     71 - 140
SKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL        141 - 206
//

Text Mined References (53)

PMID Year Title