Property Summary

NCBI Gene PubMed Count 122
Grant Count 190
R01 Count 124
Funding $25,868,524.69
PubMed Score 614.70
PubTator Score 238.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.200 0.006
tuberculosis -1.100 0.000
diabetes mellitus -1.300 0.004
Polycystic Ovary Syndrome -1.357 0.012
Breast cancer 1.100 0.000

Synonym

Accession P08195 Q13543 4F2hc
Symbols 4F2
CD98
MDU1
4F2HC
4T2HC
NACAE
CD98HC

Gene

PANTHER Protein Class (2)

PDB

2DH2   2DH3  

Gene RIF (64)

PMID Text
26621329 exposure to diesel exhaust particle extract induces functional overexpression of the amino acid transporter LAT1/CD98hc in lung cells
26540405 Study demonstrated that the mRNA expression levels of the two system xc- subunits, SLC7A11 and SLC3A2, in peripheral white blood cells are lowered in patients with schizophrenia than healthy individuals
26493331 ubiquitylation and the resulting downregulation of CD98 can limit cell proliferation and clonal expansion.
26172215 CD98-mediated phosphorylation of focal adhesion kinase may facilitate the assembly of pro-tumorigenic signaling complexes and the subsequent amplification of a positive feedback loop of CD98/integrins/FAK/RhoA/ROCK.
25995262 HSV-1 recruited cellular fusion regulatory proteins CD98hc and beta1 integrin to the nuclear membrane for viral de-envelopment fusion.
25701737 CAP-D3 down-regulates transcription of genes that encode amino acid transporters (SLC7A5 and SLC3A2) to promote bacterial autophagy by colon epithelial cells.
25631074 Cellular biotinylated 4F2 cell-surface antigen heavy chain (4F2HC) protein is incorporated into HIV-1 Gag virus-like particles
25505297 Studied and identified the eukaryotic protein CD98hc as a partner for Brucella T4SS subunit VirB2.
25299125 The detergent-induced stabilization of the purified human 4F2hc-LAT2 complex presented here paves the way towards its crystallization and structure determination at high-resolution
25084765 High CD98hc expression is associated with non-small cell lung cancer.
More...

AA Sequence

MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELLASGDPLPSASQNAEMIET      1 - 70
GSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEK     71 - 140
NGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRC    141 - 210
RELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQI    211 - 280
DPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDI    281 - 350
ENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVT    351 - 420
QYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVML    421 - 490
WDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQN    491 - 560
ERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAA    561 - 630
//

Text Mined References (145)

PMID Year Title
26621329 2016 Aryl hydrocarbon receptor-dependent up-regulation of the heterodimeric amino acid transporter LAT1 (SLC7A5)/CD98hc (SLC3A2) by diesel exhaust particle extract in human bronchial epithelial cells.
26540405 2016 Decreased mRNA expression for the two subunits of system xc(-), SLC3A2 and SLC7A11, in WBC in patients with schizophrenia: Evidence in support of the hypo-glutamatergic hypothesis of schizophrenia.
26493331 2015 Ubiquitylation of CD98 limits cell proliferation and clonal expansion.
26172215 2015 CD99 inhibits CD98-mediated ?1 integrin signaling through SHP2-mediated FAK dephosphorylation.
25995262 2015 Herpes Simplex Virus 1 Recruits CD98 Heavy Chain and ?1 Integrin to the Nuclear Membrane for Viral De-Envelopment.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25701737 2015 Chromosome-associated protein D3 promotes bacterial clearance in human intestinal epithelial cells by repressing expression of amino acid transporters.
25505297 2015 Brucella Intracellular Life Relies on the Transmembrane Protein CD98 Heavy Chain.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25299125 2014 Detergent-induced stabilization and improved 3D map of the human heteromeric amino acid transporter 4F2hc-LAT2.
More...