Property Summary

NCBI Gene PubMed Count 128
PubMed Score 653.58
PubTator Score 238.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Lung Neoplasms 232 0.0 0.0
Disease Target Count P-value
Breast cancer 3578 1.2e-06
tuberculosis 2010 1.6e-05
diabetes mellitus 1728 3.9e-03
ependymoma 4679 6.4e-03
Polycystic ovary syndrome 360 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.100 1.2e-06
diabetes mellitus -1.300 3.9e-03
ependymoma 1.200 6.4e-03
Polycystic ovary syndrome -1.357 1.2e-02
tuberculosis -1.100 1.6e-05

Gene RIF (67)

AA Sequence

MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELLASGDPLPSASQNAEMIET      1 - 70
GSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEK     71 - 140
NGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRC    141 - 210
RELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQI    211 - 280
DPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDI    281 - 350
ENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVT    351 - 420
QYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVML    421 - 490
WDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQN    491 - 560
ERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAA    561 - 630
//

Text Mined References (151)

PMID Year Title