Property Summary

NCBI Gene PubMed Count 400
Grant Count 466
R01 Count 283
Funding $47,584,121.81
PubMed Score 1192.66
PubTator Score 1805.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (52)

Disease Z-score Confidence
Cancer 2,346 5.073 2.5
Vascular disease 281 4.052 2.0
Thrombotic thrombocytopenic purpura 14 3.707 1.9
Kidney disease 396 3.257 1.6
Keratitis 42 3.213 1.6
diabetes mellitus 1,663 3.027 1.5
Breast cancer 3,094
Carcinoma 2,147 1.0
Diabetic Retinopathy 53
Fibrosis 40
Juvenile arthritis 124
Liver Cirrhosis 101
Mammary Neoplasms 410
Nephritis, Interstitial 10
Polycystic Ovary Syndrome 332
Reperfusion Injury 84
Schizophrenia 501
X-linked cerebral adrenoleukodystrophy 115
active Crohn's disease 918
active ulcerative colitis 477
adrenocortical adenoma 134
adrenocortical carcinoma 1,427
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
colon cancer 1,475
cystic fibrosis 1,665
esophageal adenocarcinoma 737
gastric carcinoma 832
glioblastoma 5,572
group 3 medulloblastoma 2,254
head and neck cancer 270
head and neck cancer and chronic obstruc... 237 
hepatocellular carcinoma 532
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
mucosa-associated lymphoid tissue lympho... 480 
nasopharyngeal carcinoma 1,056
non diabetic and post-ischemic heart fai... 200 
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pituitary cancer 1,972
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
tuberculosis 1,557

Expression

Synonym

Accession P07996 A8K6H4 B4E3J7 B9EGH6 Q15667 Q59E99
Symbols TSP
THBS
TSP1
TSP-1
THBS-1

Gene

PDB

1LSL   1UX6   1Z78   1ZA4   2ERF   2ES3   2OUH   2OUJ   3R6B   5FOE  

Gene RIF (324)

PMID Text
26768578 In the current study Factor V Leiden, prothrombin G20210A, and thrombospondin-1 polymorphisms showed no association with severity of hepatic fibrosis.
26728995 TSP-1 regulates multiple microRNAs in VSMCs adding a new layer of complexity to TSP-1 regulation of VSMC function
26676551 quercetin could increase TSP-1 expression to inhibit angiogenesis resulting in antagonizing prostate cancer PC-3 cell and xenograft tumor growth
26471266 DLL4/Notch1 and BMP9 interdependent signaling induces endothelial cell quiescence via P27KIP1/thrombospondin pathway.
26464514 The anti-angiogenic activity of the native TSP-1 active fragment was maintained in the new TSP-1 mimetics and the results provide a new chemical approach for the design of TSP-1 mimetics.
26368265 increased plasma thrombospondin-1 concentrations following ICH are independently associated with injury severity and short-term and long-term clinical outcomes
26298466 Serum THBS1 is a useful biological marker of obesity and metabolic syndrome in Japanese subjects, particularly in women. THBS1 may act as a critical circulating factor that couples obesity with metabolic syndrome and diabetes in humans
26296896 Plasma thrombospondin-1 concentrations are elevated obviously and are highly associated with long-term outcome of ischemic stroke
26168731 determined if structural differences of the TSPs imparted different effects on vascular smooth muscle cell functions critical to the formation of neointimal hyperplasia
25976449 The THBS1 N700S polymorphism was associated with coronary artery disease risk.
More...

AA Sequence

MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPV      1 - 70
PDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHV     71 - 140
VSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQG    141 - 210
VLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSM    211 - 280
VLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKK    281 - 350
VSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT    351 - 420
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACP    421 - 490
INGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQICNKQDCPIDGCLSNPCFAGV    491 - 560
KCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACFNHNGEHRCENTDPGYNCLPCPPRFTGSQPF    561 - 630
GQGVEHATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPN    631 - 700
ENLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDV    701 - 770
GDRCDNCPYNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH    771 - 840
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDKDNC    841 - 910
RLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVR    911 - 980
HQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDT    981 - 1050
NPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGF   1051 - 1120
IRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP                       1121 - 1170
//

Text Mined References (409)

PMID Year Title
26768578 2016 Association of thrombogenic genes polymorphisms with hepatocellular carcinoma in HCV Egyptian patients.
26728995 2016 Thrombospondin-1 differentially regulates microRNAs in vascular smooth muscle cells.
26676551 2016 Quercetin inhibits angiogenesis through thrombospondin-1 upregulation to antagonize human prostate cancer PC-3 cell growth in vitro and in vivo.
26627825 2016 Extracellular Fibrinogen-binding Protein (Efb) from Staphylococcus aureus Inhibits the Formation of Platelet-Leukocyte Complexes.
26471266 2015 DLL4/Notch1 and BMP9 Interdependent Signaling Induces Human Endothelial Cell Quiescence via P27KIP1 and Thrombospondin-1.
26464514 2015 Cyclic thrombospondin-1 mimetics: grafting of a thrombospondin sequence into circular disulfide-rich frameworks to inhibit endothelial cell migration.
26395742 2016 Angiogenic microRNAs Linked to Incidence and Progression of Diabetic Retinopathy in Type 1 Diabetes.
26368265 2015 Changes in plasma thrombospondin-1 concentrations following acute intracerebral hemorrhage.
26298466 2015 Thrombospondin 1 as a novel biological marker of obesity and metabolic syndrome.
26296896 2015 Predictive value of thrombospondin-1 for outcomes in patients with acute ischemic stroke.
More...