Property Summary

NCBI Gene PubMed Count 426
PubMed Score 1281.62
PubTator Score 1805.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (37)

Disease log2 FC p
active Crohn's disease -1.576 1.6e-02
active ulcerative colitis -1.878 1.7e-02
adrenocortical adenoma -1.202 6.9e-03
adrenocortical carcinoma -1.244 2.4e-03
atypical teratoid / rhabdoid tumor 1.400 9.8e-03
autosomal dominant Emery-Dreifuss muscul... 1.140 1.7e-02
Breast cancer 1.300 9.1e-04
colon cancer -1.300 2.0e-02
cystic fibrosis -1.628 2.8e-03
esophageal adenocarcinoma 1.700 3.9e-02
gastric carcinoma 1.700 3.7e-02
glioblastoma 1.200 2.3e-02
group 3 medulloblastoma 2.200 8.9e-03
head and neck cancer 1.400 2.4e-02
head and neck cancer and chronic obstruc... 1.200 9.6e-04
hepatocellular carcinoma -1.100 3.6e-02
interstitial cystitis 2.800 1.3e-04
intraductal papillary-mucinous adenoma (... -2.900 3.2e-04
intraductal papillary-mucinous carcinoma... -2.200 2.3e-03
intraductal papillary-mucinous neoplasm ... -3.300 5.2e-03
invasive ductal carcinoma 1.200 2.1e-02
lung cancer -1.200 1.0e-02
lung carcinoma -2.600 1.6e-15
malignant mesothelioma 1.200 7.9e-06
medulloblastoma, large-cell -1.600 2.2e-02
mucosa-associated lymphoid tissue lympho... 3.029 6.8e-03
nasopharyngeal carcinoma 1.500 1.0e-02
non diabetic and post-ischemic heart fai... -1.200 3.3e-02
osteosarcoma 2.545 9.2e-03
ovarian cancer 1.300 5.7e-05
pancreatic cancer 2.200 3.3e-03
pituitary cancer -2.100 1.2e-04
Polycystic ovary syndrome -2.596 1.6e-02
primary pancreatic ductal adenocarcinoma 2.081 1.3e-02
psoriasis -1.100 1.4e-02
tuberculosis -3.100 3.9e-07
X-linked cerebral adrenoleukodystrophy 2.000 4.4e-02

Gene RIF (347)

AA Sequence

MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPV      1 - 70
PDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHV     71 - 140
VSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQG    141 - 210
VLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSM    211 - 280
VLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKK    281 - 350
VSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT    351 - 420
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACP    421 - 490
INGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQICNKQDCPIDGCLSNPCFAGV    491 - 560
KCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACFNHNGEHRCENTDPGYNCLPCPPRFTGSQPF    561 - 630
GQGVEHATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPN    631 - 700
ENLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDV    701 - 770
GDRCDNCPYNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH    771 - 840
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDKDNC    841 - 910
RLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVR    911 - 980
HQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDT    981 - 1050
NPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGF   1051 - 1120
IRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP                       1121 - 1170
//

Text Mined References (435)

PMID Year Title