Property Summary

NCBI Gene PubMed Count 138
PubMed Score 695.44
PubTator Score 656.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 6.9e-04
glioblastoma 1.100 1.9e-04
lung adenocarcinoma -1.300 1.1e-03
lung cancer -6.200 2.5e-08
lung carcinoma -5.300 4.1e-54
malignant mesothelioma 1.400 5.7e-06
medulloblastoma, large-cell 1.400 5.1e-05
non-small cell lung cancer -2.840 7.5e-08
osteosarcoma 1.489 8.3e-06
ovarian cancer 1.400 8.3e-08

Protein-protein Interaction (2)

Gene RIF (123)

AA Sequence

MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQ      1 - 70
ECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHL     71 - 140
GLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWL    141 - 210
CRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMD    211 - 280
DSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLV    281 - 350
PRGWDAHTTCQALGVCGTMSSPLQCIHSPDL                                           351 - 381
//

Text Mined References (140)

PMID Year Title