Property Summary

NCBI Gene PubMed Count 131
PubMed Score 661.15
PubTator Score 656.74

Knowledge Summary


No data available


  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
osteosarcoma 1.489 0.000
atypical teratoid / rhabdoid tumor 1.200 0.001
glioblastoma 1.100 0.000
medulloblastoma, large-cell 1.400 0.000
non-small cell lung cancer -3.489 0.000
lung cancer -9.800 0.000
lung adenocarcinoma -1.300 0.001
lung carcinoma -5.300 0.000
ovarian cancer 1.400 0.000


Accession P07988 Q96R04 SP-B
Symbols SP-B



1DFW   1KMR   1RG3   1RG4   1SSZ   2DWF   2JOU   2M0H   2M1T  

  Ortholog (10)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

Gene RIF (116)

26950992 Significant differences in frequency of occurrence of unfavorable genotypes CC rs1965708, AA rs1059046 of SFTPA2 gene and CC rs1130866 of SFTPB gene in influenza patients in comparison with individuals of the control group were not detected.
26620227 These results demonstrate for the first time that human SP-B C allele is more susceptible to bacterial pneumonia than SP-B T allele in vivo.
26107393 In term newborns with pneumonia, SP-B increases with respect to total phospholipids, and disaturated-phosphatidylcholine and is turned over at a faster rate.
26061924 Investigated the relationship between SP-A2 and SP-B gene polymorphisms and respiratory distress syndrome in preterm neonates.
26045806 SP-B -18C/A and 1580C/T polymorphisms are associated with bronchopulmonary dysplasia
25565191 Given these fact SP-B deficiency may be considered as a further field for research on regenerative therapy i. e. stem cell administration in models of postnatal SP-B deficiency.
25360829 Results support a critical role of SP-B for promoting pulmonary surface film formation.
25299874 SFTPB variants are associated with chronic obstructive pulmonary disease susceptibility and lung function in the Chinese Han population.
24337193 Surfactant protein B gene polymorphism is associated with severe influenza.
24163141 Glucocorticoids mediated surfactant protein B production, maturation, and release is amplified by caffeine.

AA Sequence

PRGWDAHTTCQALGVCGTMSSPLQCIHSPDL                                           351 - 381

Text Mined References (133)

PMID Year Title
26620227 2016 Differential susceptibility of transgenic mice expressing human surfactant protein B genetic variants to Pseudomonas aeruginosa induced pneumonia.
26107393 2015 Surfactant protein B and A concentrations are increased in neonatal pneumonia.
26061924 2015 Human Surfactant Proteins A2 (SP-A2) and B (SP-B) Genes as Determinants of Respiratory Distress Syndrome.
26045806 2015 Surfactant protein B gene polymorphisms is associated with risk of bronchopulmonary dysplasia in Chinese Han population.
25565191 2015 Stem cells for neonatal lung disease caused by SP-B deficiency?
25360829 2015 Surface film formation in vitro by infant and therapeutic surfactants: role of surfactant protein B.
25299874 2014 Association of surfactant protein B gene with chronic obstructive pulmonary disease susceptibility.
24337193 2014 Surfactant protein B gene polymorphism is associated with severe influenza.
24163141 2014 Amplification of steroid-mediated SP-B expression by physiological levels of caffeine.