Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.15
PubTator Score 180.63

Knowledge Summary

Patent

No data available

Synonym

Accession P07438 Q86YX0 MT-1B
Symbols MT1
MTP
MT1Q
MT-1B
MT-IB

Gene

Gene RIF (2)

PMID Text
15747776 Eight MT genes were up-regulated after treatment of T-ALL cells with 0.15 and 1.5 microg/mL of metal ores. Copper/cadmium/zinc ore binding.
12539042 Microarray analysis indicates HIV-1 Tat upregulates the interferon-responsive gene expression of many proteins, including Metallothionein, in immature dendritic cells, an effect that likely facilitates the expansion of HIV-1 infection

AA Sequence

MDPNCSCTTGGSCACAGSCKCKECKCTSCKKCCCSCCPVGCAKCAQGCVCKGSSEKCRCCA               1 - 61
//

Text Mined References (11)

PMID Year Title
23064051 2013 Metallothionein 1F and 2A overexpression predicts poor outcome of non-small cell lung cancer patients.
22780124 2013 Genome-wide association study of a quantitative disordered gambling trait.
17244347 2007 Pathways and genes differentially expressed in the motor cortex of patients with sporadic amyotrophic lateral sclerosis.
15747776 2003 Dose-dependent transcriptome changes by metal ores on a human acute lymphoblastic leukemia cell line.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11168427 2001 Metallothionein isogene transcription in red blood cell precursors from human cord blood.
6089206 1984 Human metallothionein genes are clustered on chromosome 16.
3785191 1986 Structure and tissue-specific expression of the human metallothionein IB gene.
More...