Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.80
PubTator Score 180.63

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MDPNCSCTTGGSCACAGSCKCKECKCTSCKKCCCSCCPVGCAKCAQGCVCKGSSEKCRCCA               1 - 61
//

Text Mined References (11)

PMID Year Title