Property Summary

NCBI Gene PubMed Count 42
Grant Count 22
R01 Count 10
Funding $7,131,470.16
PubMed Score 201.76
PubTator Score 195.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma 1.093 0.006
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 2.100 0.000
medulloblastoma, large-cell 1.200 0.000
pediatric high grade glioma 1.300 0.000

Gene RIF (19)

PMID Text
25942623 CENP-B directly binds both CENP-A's amino-terminal tail and CENP-C, a key nucleator of kinetochore assembly
25916850 The results revealed that CENP-B binding in the vicinity of the CENP-A nucleosome substantially stabilizes the CENP-A nucleosome on alphoid DNA in human cells.
25281565 Centromere protein B (CENP-B) as a novel interacting partner of HBZ.
24633075 INMAP as a model regulator of CENP-B
23978223 N-terminal methylation is required for CENP-B's binding to the CENP-B box.
23325853 Human Nap1, an acidic histone chaperone, inhibited the non-specific binding of CENP-B to nucleosomes and apparently stimulated CENP-B binding to its cognate CENP-B box DNA.
22467948 CENP-A and/or B status is predictive of the extent of skin involvement over time in systemic sclerosis.
20222802 Anti-CENP-B autoantibodies in breast cancer patients prolong disease-free and overall survival.
19723035 Study analyzed the distribution of PARP-1 and its interaction with CENP-B, -E, and -F during mitosis and apoptosis.
19714638 CENP-B binding stimulated the cross-talk between CCR3 and epidermal growth factor receptor (EGFR) in human pulmonary artery smooth muscle cells.
More...

AA Sequence

MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNK      1 - 70
LSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASNGWLDRFRRRHGVVSCSGVAR     71 - 140
ARARNAAPRTPAAPASPAAVPSEGSGGSTTGWRAREEQPPSVAEGYASQDVFSATETSLWYDFLPDQAAG    141 - 210
LCGGDGRPRQATQRLSVLLCANADGSEKLPPLVAGKSAKPRAGQAGLPCDYTANSKGGVTTQALAKYLKA    211 - 280
LDTRMAAESRRVLLLAGRLAAQSLDTSGLRHVQLAFFPPGTVHPLERGVVQQVKGHYRQAMLLKAMAALE    281 - 350
GQDPSGLQLGLTEALHFVAAAWQAVEPSDIAACFREAGFGGGPNATITTSLKSEGEEEEEEEEEEEEEEG    351 - 420
EGEEEEEEGEEEEEEGGEGEELGEEEEVEEEGDVDSDEEEEEDEESSSEGLEAEDWAQGVVEAGGSFGAY    421 - 490
GAQEEAQCPTLHFLEGGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVKRYLTS    491 - 560
FPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS                                   561 - 599
//

Text Mined References (49)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
25942623 2015 DNA Sequence-Specific Binding of CENP-B Enhances the Fidelity of Human Centromere Function.
25916850 2015 Stable complex formation of CENP-B with the CENP-A nucleosome.
25281565 2015 HTLV-1 bZIP factor suppresses the centromere protein B (CENP-B)-mediated trimethylation of histone H3K9 through the abrogation of DNA-binding ability of CENP-B.
24633075 2014 A regulatory effect of INMAP on centromere proteins: antisense INMAP induces CENP-B variation and centromeric halo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23978223 2013 Identification of novel ?-n-methylation of CENP-B that regulates its binding to the centromeric DNA.
23325853 2013 Nap1 regulates proper CENP-B binding to nucleosomes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22467948 2012 Clinical correlates of CENP-A and CENP-B antibodies in a large cohort of patients with systemic sclerosis.
More...