Property Summary

NCBI Gene PubMed Count 45
PubMed Score 207.84
PubTator Score 195.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 1.3e-05
glioblastoma 2.100 7.7e-08
malignant mesothelioma 1.300 2.7e-06
medulloblastoma, large-cell 1.200 3.5e-04
osteosarcoma 1.093 6.2e-03
pediatric high grade glioma 1.300 3.8e-04

Gene RIF (22)

AA Sequence

MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNK      1 - 70
LSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASNGWLDRFRRRHGVVSCSGVAR     71 - 140
ARARNAAPRTPAAPASPAAVPSEGSGGSTTGWRAREEQPPSVAEGYASQDVFSATETSLWYDFLPDQAAG    141 - 210
LCGGDGRPRQATQRLSVLLCANADGSEKLPPLVAGKSAKPRAGQAGLPCDYTANSKGGVTTQALAKYLKA    211 - 280
LDTRMAAESRRVLLLAGRLAAQSLDTSGLRHVQLAFFPPGTVHPLERGVVQQVKGHYRQAMLLKAMAALE    281 - 350
GQDPSGLQLGLTEALHFVAAAWQAVEPSDIAACFREAGFGGGPNATITTSLKSEGEEEEEEEEEEEEEEG    351 - 420
EGEEEEEEGEEEEEEGGEGEELGEEEEVEEEGDVDSDEEEEEDEESSSEGLEAEDWAQGVVEAGGSFGAY    421 - 490
GAQEEAQCPTLHFLEGGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVKRYLTS    491 - 560
FPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS                                   561 - 599
//

Text Mined References (54)

PMID Year Title