Property Summary

NCBI Gene PubMed Count 81
Grant Count 254
R01 Count 126
Funding $46,976,179.52
PubMed Score 658.95
PubTator Score 1444.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.428 0.026
Multiple myeloma 2.539 0.000
astrocytic glioma -1.600 0.016
oligodendroglioma -1.100 0.000
non-small cell lung cancer 1.554 0.000
lung cancer 2.100 0.000
lung adenocarcinoma 1.496 0.000
Pick disease -1.200 0.003
Breast cancer 1.400 0.000
ovarian cancer 3.200 0.000

Synonym

Accession P06744 B4DG39 Q9BRD3 Q9BSK5 Q9UHE6 GPI
Symbols AMF
NLK
PGI
PHI
GNPI
SA36
SA-36

Gene

GPI

PANTHER Protein Class (1)

PDB

1IAT   1IRI   1JIQ   1JLH   1NUH  

Gene RIF (48)

PMID Text
26579829 Results showed an increase in GPI and AMFR in clear cell-renal cell carcinoma cells, and their colocalization on plasma membrane. Kaplan-Meier curves showed significant differences in survival among groups of patients with high versus low GPI.
26573126 NLK is able to promote cell proliferation and type II collagen synthesis during in vitro chondrocyte propagation.
26308071 Suggest tha AMF/PGI-mediated tumorigenesis occurs through MAPK-ERK signaling in endometrial carcinoma.
26201353 Study supports a role for AMF mediating epithelial-mesenchymal transition in endometrial cancer (EC) through MAPK signaling. Therefore, AMF may provide a potential prognostic and therapeutic target in preventing EC progression.
25910678 The association of ENO1 and GPI with postthaw sperm viability and motility was confirmed using Pearson's linear correlation. ENO1 and GPI can be used as markers of human sperm freezability before starting the cryopreservation procedure.
24440856 High GPI expression is associated with metastatic phenotype of breast cancer.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of glucose-6-phosphate isomerase (GPI) expression by HIV-1 Vpr in Vpr transduced macrophages
23773638 Serum anti-GPI autoantibodies are useful for the diagnosis of rheumatoid arthritis in Chinese patients.
23248119 Findings suggest that autocrine motility factor (AMF)-HER2 interaction might be a novel target for therapeutic management of patients with breast cancer, whose disease is resistant to trastuzumab.
23166591 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of glucose-6-phosphate isomerase (GPI) expression by HIV-1 Vpr in Vpr transduced macrophages
More...

AA Sequence

MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVD      1 - 70
LAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGD     71 - 140
WKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIAS    141 - 210
KTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAI    211 - 280
GLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAA    281 - 350
YFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL    351 - 420
HHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGAL    421 - 490
VAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ      491 - 558
//

Text Mined References (97)

PMID Year Title
26579829 2015 Increased Expression of the Autocrine Motility Factor is Associated With Poor Prognosis in Patients With Clear Cell-Renal Cell Carcinoma.
26573126 2016 Microfluidics?based optimization of neuroleukin?mediated regulation of articular chondrocyte proliferation.
26308071 2015 AMF/PGI-mediated tumorigenesis through MAPK-ERK signaling in endometrial carcinoma.
26201353 2015 Autocrine motility factor promotes epithelial-mesenchymal transition in endometrial cancer via MAPK signaling pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25910678 2015 Enolase1 (ENO1) and glucose-6-phosphate isomerase (GPI) are good markers to predict human sperm freezability.
24810856 2014 Polyubiquitylation of AMF requires cooperation between the gp78 and TRIM25 ubiquitin ligases.
24440856 2014 GPI/AMF inhibition blocks the development of the metastatic phenotype of mature multi-cellular tumor spheroids.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23773638 2013 Comparison of anti-mutated citrullinated vimentin, anti-cyclic citrullinated peptides, anti-glucose-6-phosphate isomerase and anti-keratin antibodies and rheumatoid factor in the diagnosis of rheumatoid arthritis in Chinese patients.
More...