Property Summary

NCBI Gene PubMed Count 47
Grant Count 134
R01 Count 81
Funding $22,008,804.7
PubMed Score 838.17
PubTator Score 340.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.163 0.004
malignant mesothelioma -1.300 0.000
osteosarcoma -3.146 0.000
tuberculosis and treatment for 6 months 1.700 0.000
ovarian cancer -1.800 0.000
dermatomyositis 1.200 0.001

Synonym

Accession P06132 A8K762 Q16863 Q16883 Q53YB8 Q53ZP6 Q6IB28 Q9BUZ0 UPD
Symbols PCT
UPD

Gene

PANTHER Protein Class (2)

PDB

1JPH   1JPI   1JPK   1R3Q   1R3R   1R3S   1R3T   1R3V   1R3W   1R3Y   1URO   2Q6Z   2Q71   3GVQ   3GVR   3GVV   3GVW   3GW0   3GW3  

Gene RIF (18)

PMID Text
26789143 a new mutation in the UROD gene in Egyptian patients with Hepatoerythropoietic porphyria, is reported.
24777812 a new insight in the conformational changes occurred in the mutant structures of UROD protein.
24551192 HIV-1 Vpu-expressing U937 monocytes coculture with LX2 stellate cells to upregulate expression of profibrogenic markers COL-1, PCT, SMA-1, VEGF, and MMP2, which is inhibited by MIF treatment
23545314 Among seventeen F-PCT patients, sixteen UROD mutations were identified.
23209648 analysis of uroporphyrinogen decarboxylase as a potential target for specific components of traditional Chinese medicine
23140436 Data suggest that the traditional Chinese medicine (TCM) candidate potential three-in-one inhibitors for three drug target proteins epidermal growth factor receptor (EGFR), Her2, and uroporphyrinogen decarboxylase (UROD) against head and neck cancer.
22382040 Mutations in UROD gene is associated with familial porphyria cutanea tarda.
21079081 Hepatoerythropoietic porphyria and familial porphyria cutanea tarda G281E mutation in the uroporphyrinogen decarboxylase gene
20553007 function of Arg37 in uroporphyrinogen III decarboxylase
20479301 description of 3 siblings with hepatoerythropoietic porphyria; sequencing of the UROD gene revealed compound heterozygosity for a novel missense mutation, V166A, and a complex deletion/insertion, 645del1053ins10
More...

AA Sequence

MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTL      1 - 70
QPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITL     71 - 140
TRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAG    141 - 210
AQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVV    211 - 280
GLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHV    281 - 350
GAFVDAVHKHSRLLRQN                                                         351 - 367
//

Text Mined References (54)

PMID Year Title
26789143 2015 Hepatoerythropoietic Porphyria Caused by a Novel Homoallelic Mutation in Uroporphyrinogen Decarboxylase Gene in Egyptian Patients.
25416956 2014 A proteome-scale map of the human interactome network.
24777812 2014 Computational identification of pathogenic associated nsSNPs and its structural impact in UROD gene: a molecular dynamics approach.
23545314 2013 Familial porphyria cutanea tarda in Spain: characterization of eight novel mutations in the UROD gene and haplotype analysis of the common p.G281E mutation.
23209648 2012 Uroporphyrinogen decarboxylase as a potential target for specific components of traditional Chinese medicine: a virtual screening and molecular dynamics study.
23140436 2013 A possible strategy against head and neck cancer: in silico investigation of three-in-one inhibitors.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22382040 2012 Molecular analysis of the UROD gene in 17 Argentinean patients with familial porphyria cutanea tarda: characterization of four novel mutations.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21668429 2011 Hepatoerythropoietic porphyria due to a novel mutation in the uroporphyrinogen decarboxylase gene.
More...