Property Summary

NCBI Gene PubMed Count 47
PubMed Score 872.36
PubTator Score 340.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Porphyria cutanea tarda 12 7.309 3.7
Head and Neck Neoplasms 26 0.0 0.0
Disease Target Count Z-score Confidence
Porphyria 10 0.0 5.0
Disease Target Count
Hepatoerythropoietic porphyria 5

Expression

  Differential Expression (6)

Disease log2 FC p
dermatomyositis 1.200 6.8e-04
malignant mesothelioma -1.300 1.6e-05
osteosarcoma -2.543 1.6e-06
ovarian cancer -1.800 3.4e-08
tuberculosis and treatment for 6 months 1.700 2.3e-05
Waldenstrons macroglobulinemia 1.163 4.5e-03

Protein-protein Interaction (1)

Gene RIF (18)

AA Sequence

MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTL      1 - 70
QPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITL     71 - 140
TRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAG    141 - 210
AQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVV    211 - 280
GLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHV    281 - 350
GAFVDAVHKHSRLLRQN                                                         351 - 367
//

Text Mined References (54)

PMID Year Title