Property Summary

NCBI Gene PubMed Count 105
PubMed Score 289.32
PubTator Score 1377.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.172 2.6e-06
gastric carcinoma 1.200 4.2e-02
juvenile dermatomyositis 1.168 2.1e-12
lung adenocarcinoma 1.467 3.3e-07
lung cancer 2.000 9.8e-05
osteosarcoma -1.492 3.1e-05
ovarian cancer 1.100 4.6e-03
progressive supranuclear palsy -1.300 4.6e-03
psoriasis -1.600 8.5e-05

Gene RIF (75)

AA Sequence

MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVE      1 - 70
ALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNI     71 - 140
QMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVEAKLRAKQE    141 - 210
QEAKQKLEEDAEMKSLEEKIGCLLKFSGDLDDQTCREDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAK    211 - 280
EALGKAKDANNGNLQLRNKEVTWEVLEGEVEKEALKKIIEDQQESLNKWKSKGRRFKGKGKGNKAAQPGS    281 - 350
GKGKVQFQGKKTKFASDDEHDEHDENGATGPVKRAREETDKEEPASKQQKTENGAGDQ                351 - 408
//

Text Mined References (118)

PMID Year Title