Property Summary

NCBI Gene PubMed Count 98
Grant Count 39
R01 Count 21
Funding $3,540,968.93
PubMed Score 278.93
PubTator Score 1377.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -1.492 0.000
juvenile dermatomyositis 1.168 0.000
acute quadriplegic myopathy 1.172 0.000
lung cancer 2.000 0.000
lung adenocarcinoma 1.467 0.000
progressive supranuclear palsy -1.300 0.005
gastric carcinoma 1.200 0.042
ovarian cancer 1.800 0.001

Gene RIF (69)

PMID Text
26339049 At the 3' UTR, HUR facilitates circularization of the viral genome through interaction with another host factor, La, which is critical for replication.
25845745 Endoplasmic reticulum stress causes autophagy and apoptosis leading to cellular redistribution of the SS-A and SS-B autoantigens in salivary gland epithelial cells of Sjogren's syndrome patients.
25582858 expression of nuclear hLa Ag induces thymic clonal deletion and tTreg selection, and lymphocytic infiltration of the lung is a consequence of La-specific CD4(+) T cell autoimmunity
25520193 Authors provide a model whereby a novel interplay between RNA-binding, RNA chaperoning and AKT phosphorylation of La protein regulates CCND1 IRES-mediated translation.
24529195 Primary Sjogren's patients with WSP form a benign subgroup, with a lower prevalence of anti-SSB and extraglandular manifestations.
24478427 A beta turn in the human La protein is responsible for the interaction with the hepatitis C virus RNA.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of Sjogren syndrome antigen B (SSB, autoantigen La) expression by HIV-1 Vpr in Vpr transduced macrophages
23554036 Total IgG levels correlate positively with autoantibodies La, Ro60 and Ro52 but not with RING or B-box domain antibodies of Ro52.
23552417 Our study demonstrates that La plays a critical role in regulating HCV replication by interacting with the GCAC motif.
23129761 Sjogren syndrome antigen B (SSB)/La promotes global microRNA expression by binding microRNA precursors through stem-loop recognition
More...

AA Sequence

MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVE      1 - 70
ALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNI     71 - 140
QMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVEAKLRAKQE    141 - 210
QEAKQKLEEDAEMKSLEEKIGCLLKFSGDLDDQTCREDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAK    211 - 280
EALGKAKDANNGNLQLRNKEVTWEVLEGEVEKEALKKIIEDQQESLNKWKSKGRRFKGKGKGNKAAQPGS    281 - 350
GKGKVQFQGKKTKFASDDEHDEHDENGATGPVKRAREETDKEEPASKQQKTENGAGDQ                351 - 408
//

Text Mined References (112)

PMID Year Title
26339049 2015 HuR Displaces Polypyrimidine Tract Binding Protein To Facilitate La Binding to the 3' Untranslated Region and Enhances Hepatitis C Virus Replication.
25845745 2015 Endoplasmic reticulum stress causes autophagy and apoptosis leading to cellular redistribution of the autoantigens Ro/Sjögren's syndrome-related antigen A (SSA) and La/SSB in salivary gland epithelial cells.
25616068 2015 A combined proteomics/genomics approach links hepatitis C virus infection with nonsense-mediated mRNA decay.
25582858 2015 Defective selection of thymic regulatory T cells accompanies autoimmunity and pulmonary infiltrates in Tcra-deficient mice double transgenic for human La/Sjögren's syndrome-B and human La-specific TCR.
25520193 2015 Novel RNA chaperone domain of RNA-binding protein La is regulated by AKT phosphorylation.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24529195 Lower prevalence of extra-glandular manifestations and anti-SSB antibodies in patients with primary Sjögren's syndrome and widespread pain: evidence for a relatively benign subset.
24478427 2014 Specific sequence of a Beta turn in human la protein may contribute to species specificity of hepatitis C virus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23554036 2013 Autoantibodies to the functionally active RING-domain of Ro52/SSA are associated with disease activity in patients with lupus.
More...