Property Summary

NCBI Gene PubMed Count 758
PubMed Score 12851.87
PubTator Score 5752.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Hypertension 396 7.372 3.7
Asthma 385 4.065 2.0
Acute Lung Injury 22 0.0 0.0
Acute kidney injury 70 0.0 0.0
Arrhythmias, Cardiac 19 0.0 0.0
Atrial Fibrillation 124 0.0 0.0
Auriculo-condylar syndrome 3 0.0 0.0
Bradycardia 36 0.0 0.0
Cardiomegaly 116 0.0 0.0
Cardiomyopathies 110 0.0 0.0
Cardiovascular Abnormalities 31 0.0 0.0
Cardiovascular Diseases 59 0.0 0.0
Cartilage Diseases 6 0.0 0.0
Cell Transformation, Neoplastic 97 0.0 0.0
Cerebrovascular Disorders 2 0.0 0.0
Craniofacial Abnormalities 151 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetes Mellitus, Type 2 142 0.0 0.0
Erectile dysfunction 32 0.0 0.0
Gastrointestinal Diseases 12 0.0 0.0
Glomerulosclerosis, Focal Segmental 28 0.0 0.0
Heart Defects, Congenital 37 0.0 0.0
Heart failure 162 0.0 0.0
Hepatorenal syndrome 6 0.0 0.0
Hernia, Diaphragmatic 40 0.0 0.0
Hyperalgesia 83 0.0 0.0
Hypercholesterolemia 44 0.0 0.0
Hypertension, Pulmonary 37 0.0 0.0
Hypertrophy 17 0.0 0.0
Hypertrophy, Left Ventricular 24 0.0 0.0
Hypotension 82 0.0 0.0
Infarction, Middle Cerebral Artery 33 0.0 0.0
Inflammation 120 0.0 0.0
Kidney Diseases 114 0.0 0.0
Lewy Body Disease 21 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Myocardial Ischemia 169 0.0 0.0
Myocardial Reperfusion Injury 37 0.0 0.0
Nephrosis 21 0.0 0.0
Oral Ulcer 15 0.0 0.0
Pain 103 0.0 0.0
Parkinson Disease 64 0.0 0.0
Peptic Ulcer 27 0.0 0.0
Pre-Eclampsia 68 0.0 0.0
Premature Birth 77 0.0 0.0
Pulmonary Fibrosis 106 0.0 0.0
Renal Insufficiency 90 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Respiratory Distress Syndrome, Adult 40 0.0 0.0
Stroke 33 0.0 0.0
Subarachnoid Hemorrhage 7 0.0 0.0
Ureteral obstruction 33 0.0 0.0
Urinary Bladder, Overactive 4 0.0 0.0
Urinary Retention 6 0.0 0.0

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.200 9.5e-03
Astrocytoma, Pilocytic -1.500 9.1e-07
Breast cancer -3.000 3.9e-02
breast carcinoma -1.700 3.7e-05
ductal carcinoma in situ -1.100 1.4e-03
ependymoma -1.200 4.3e-04
glioblastoma -1.300 7.5e-07
group 3 medulloblastoma -1.800 9.1e-05
invasive ductal carcinoma -1.101 4.4e-02
lung adenocarcinoma -2.000 5.3e-11
lung cancer -1.500 6.1e-04
lung carcinoma -3.700 8.9e-21
malignant mesothelioma 1.100 3.9e-05
medulloblastoma, large-cell -1.700 2.2e-04
non-small cell lung cancer -2.068 8.5e-15
ovarian cancer 1.200 2.2e-04
pancreatic ductal adenocarcinoma liver m... 1.320 4.2e-02
primitive neuroectodermal tumor -1.100 4.4e-02
spina bifida -1.225 2.7e-02
ulcerative colitis -1.200 2.9e-05

Gene RIF (750)

AA Sequence

MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLD      1 - 70
IIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWN     71 - 140
NHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGKPSRERYVTHNRA    141 - 210
HW                                                                        211 - 212
//

Text Mined References (758)

PMID Year Title