Property Summary

NCBI Gene PubMed Count 711
Grant Count 1,324
R01 Count 830
Funding $171,994,691.03
PubMed Score 12467.90
PubTator Score 5752.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (97)

Disease Z-score Confidence
Hypertension 287 7.328 3.7
Heart disease 279 5.712 2.9
Kidney disease 396 5.498 2.7
Atherosclerosis 275 5.467 2.7
Coronary artery disease 240 5.381 2.7
Cerebrovascular disease 231 5.357 2.7
Portal hypertension 21 5.247 2.6
diabetes mellitus 1,663 5.159 2.6
Systemic scleroderma 66 5.032 2.5
Hepatopulmonary syndrome 6 4.614 2.3
Lung disease 132 4.487 2.2
Liver Cirrhosis 101 4.442 2.2
Glaucoma 134 4.38 2.2
Cancer 2,346 4.16 2.1
Asthma 349 4.059 2.0
Impotence 45 3.984 2.0
Peripheral vascular disease 90 3.931 2.0
Obesity 616 3.608 1.8
Obstructive sleep apnea 28 3.513 1.8
Hyperglycemia 120 3.412 1.7
Metabolic syndrome X 155 3.327 1.7
Diabetic Retinopathy 53 3.256 1.6
Hyperinsulinism 63 3.162 1.6
Congenital diaphragmatic hernia 43 3.036 1.5
AURICULOCONDYLAR SYNDROME 3 1
Acute Lung Injury 18
Acute kidney injury 65
Atrial Fibrillation 110
Auriculo-condylar syndrome 3
Bradycardia 24
Breast cancer 3,094
Cardiac Arrhythmia 20
Cardiomegaly 66
Cardiomyopathies 90
Cardiovascular Abnormalities 7
Cardiovascular Diseases 50
Cartilage Diseases 5
Cerebrovascular Disorders 2
Cerebrovascular accident 44
Congenital Heart Defects 37
Craniofacial Abnormalities 147
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Non-Insulin-Dependent 157
Diaphragmatic Hernia 40
Erectile dysfunction 10
Focal glomerulosclerosis 22
Gastrointestinal Diseases 12
Heart failure 80
Hepatorenal syndrome 5
Hyperalgesia 71
Hypercholesterolemia 27
Hypertensive disease 193
Hypotension 53
Infarction, Middle Cerebral Artery 25
Inflammation 109
Kidney Diseases 86
Left Ventricular Hypertrophy 24
Lewy Body Disease 19
Liver Cirrhosis, Experimental 108
Myocardial Ischemia 169
Myocardial Reperfusion Injury 34
Nephrosis 18
Oral Ulcer 2
Overactive Bladder 4
Pain 70
Parkinson Disease 102
Peptic ulcer 22
Peripheral Neuropathy 303
Premature Birth 9
Pulmonary Fibrosis 66
Pulmonary hypertension 52
QUESTION MARK EARS, ISOLATED 1
Renal Insufficiency 10
Reperfusion Injury 84
Respiratory Distress Syndrome, Adult 6
Subarachnoid Hemorrhage 5
Urinary Retention 1
adult high grade glioma 2,148
breast carcinoma 1,614
ductal carcinoma in situ 1,745
ependymoma 2,514
glioblastoma 5,572
group 4 medulloblastoma 1,875
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
ovarian cancer 8,484
pancreatic ductal adenocarcinoma liver m... 1,795 
pilocytic astrocytoma 3,086
pre-eclampsia 67
primitive neuroectodermal tumor 3,031
spina bifida 1,064
ulcerative colitis 2,087

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
ependymoma -1.200 0.000
glioblastoma -1.300 0.000
group 4 medulloblastoma -2.000 0.000
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -1.100 0.044
pancreatic ductal adenocarcinoma liver m... 1.518 0.048
non-small cell lung cancer -2.153 0.000
lung cancer -1.500 0.001
breast carcinoma -1.700 0.000
Breast cancer -3.000 0.039
lung adenocarcinoma -2.000 0.000
adult high grade glioma -1.200 0.009
pilocytic astrocytoma -1.800 0.000
invasive ductal carcinoma -1.500 0.002
lung carcinoma -3.700 0.000
spina bifida -1.225 0.027
ductal carcinoma in situ -1.100 0.001
ulcerative colitis -1.500 0.000
ovarian cancer 1.400 0.000

Synonym

Accession P05305 Q96DA1
Symbols ET1
QME
PPET1
ARCND3
HDLCQ7

Gene

PANTHER Protein Class (2)

PDB

1EDN   1EDP   1T7H   1V6R   5GLH  

Gene RIF (704)

PMID Text
26952167 EDN1 as a key factor towards the generation and clonal derivation of ISL1(+) vascular intermediates.
26923419 In patients with autosomal dominant polycystic kidney disease, urinary ET-1 was inversely associated with eGFR and positively correlated with total kidney volume.
26823880 Serum endothelin-1 was elevated in preeclampsia and correlated with severity of illness.
26752193 excessive ET-1 production in the setting of HIV infection impairs pulmonary endothelial function and contributes to the development of pulmonary arterial hypertension .
26710051 An increase of lipid peroxide and endothelin-1 associated with nuclear factor-kappaB activation plays an important role in the development of diabetic angiopathies.
26641207 There was no significant difference in serum EDN1 between patients with vasovagal syncope, epilepsy, and controls.
26638464 Endothelin-1 is a circulating marker of early atherosclerosis.
26617785 Congenital heart disease complicated with pulmonary artery hypertension is associated with increased circulating endothelial cell counts and ET-1 production.
26599223 Therefore, despite a clear age-specific role in the regulation of vascular tone, endogenous ET-1, acting through endothelin type A receptors, does not account for the age-related reduction in mean shear rate in the common femoral artery.
26573609 A(8002)G intronic polymorphism of pre-pro-endothelin-1 gene is associated with elevated endothelin-1 levels among Tunisian coronary patients.
More...

AA Sequence

MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLD      1 - 70
IIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWN     71 - 140
NHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGKPSRERYVTHNRA    141 - 210
HW                                                                        211 - 212
//

Text Mined References (711)

PMID Year Title
26952167 2016 Endothelin-1 supports clonal derivation and expansion of cardiovascular progenitors derived from human embryonic stem cells.
26923419 2016 Relationship of urinary endothelin-1 with estimated glomerular filtration rate in autosomal dominant polycystic kidney disease: a pilot cross-sectional analysis.
26823880 2015 Homocysteine, endothelin-1 and nitric oxide in patients with hypertensive disorders complicating pregnancy.
26752193 2016 Endothelin-1 Predicts Hemodynamically Assessed Pulmonary Arterial Hypertension in HIV Infection.
26710051 2016 Endothelin-1 Expression Associated with Lipid Peroxidation and Nuclear Factor-?B Activation in Type 2 Diabetes Mellitus Patients with Angiopathy and Limb Amputation.
26641207 2016 Assessment of endothelin and copeptin as biomarkers for vasovagal syncope.
26638464 2014 [PATIENTS WITH HAVE A LEVEL OF ENDOTHELIN-1 AN ANTIFOSFOLIPID SYNDROME: CONNECTION IS WITH MOTION OF DISEASE, DISFUNCTION OF ENDOTHELIA AND ATHEROSCLEROSIS].
26617785 2015 Correlation between congenital heart disease complicated with pulmonary artery hypertension and circulating endothelial cells as well as endothelin-1.
26599223 2016 Endogenous endothelin-1 and femoral artery shear rate: impact of age and implications for atherosclerosis.
26573609 2015 Relationship between the A(8002)G intronic polymorphism of pre-pro-endothelin-1 gene and the endothelin-1 concentration among Tunisian coronary patients.
More...