Property Summary

NCBI Gene PubMed Count 711
PubMed Score 12467.90
PubTator Score 5752.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 8.89621741647024E-21
non-small cell lung cancer 2798 3.12922542534702E-13
lung adenocarcinoma 2714 5.29838983308723E-11
glioblastoma 5572 7.53682354242545E-7
medulloblastoma, large-cell 6234 6.02740419322502E-6
pilocytic astrocytoma 3086 8.50886554598361E-6
group 4 medulloblastoma 1875 1.30264876249872E-5
breast carcinoma 1614 3.67174029312766E-5
malignant mesothelioma 3163 3.91914143609268E-5
ovarian cancer 8492 5.60315990904701E-5
ulcerative colitis 2087 2.48365755980956E-4
ependymoma 2514 4.32604010413325E-4
lung cancer 4473 6.05675807532011E-4
ductal carcinoma in situ 1745 0.00139479468477421
invasive ductal carcinoma 2950 0.00166861587712569
adult high grade glioma 2148 0.00946253335102079
spina bifida 1064 0.026905982052635
Breast cancer 3099 0.0393249929131534
primitive neuroectodermal tumor 3031 0.0436295493894728
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0483259439094363

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
ependymoma -1.200 0.000
glioblastoma -1.300 0.000
group 4 medulloblastoma -2.000 0.000
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -1.100 0.044
pancreatic ductal adenocarcinoma liver m... 1.518 0.048
non-small cell lung cancer -2.153 0.000
lung cancer -1.500 0.001
breast carcinoma -1.700 0.000
Breast cancer -3.000 0.039
lung adenocarcinoma -2.000 0.000
adult high grade glioma -1.200 0.009
pilocytic astrocytoma -1.800 0.000
invasive ductal carcinoma -1.500 0.002
lung carcinoma -3.700 0.000
spina bifida -1.225 0.027
ductal carcinoma in situ -1.100 0.001
ulcerative colitis -1.500 0.000
ovarian cancer 1.400 0.000

Synonym

Accession P05305 Q96DA1
Symbols ET1
QME
PPET1
ARCND3
HDLCQ7

Gene

PANTHER Protein Class (2)

PDB

1EDN   1EDP   1T7H   1V6R   5GLH  

  Ortholog (12)

Gene RIF (703)

PMID Text
26952167 EDN1 as a key factor towards the generation and clonal derivation of ISL1(+) vascular intermediates.
26923419 In patients with autosomal dominant polycystic kidney disease, urinary ET-1 was inversely associated with eGFR and positively correlated with total kidney volume.
26823880 Serum endothelin-1 was elevated in preeclampsia and correlated with severity of illness.
26752193 excessive ET-1 production in the setting of HIV infection impairs pulmonary endothelial function and contributes to the development of pulmonary arterial hypertension .
26710051 An increase of lipid peroxide and endothelin-1 associated with nuclear factor-kappaB activation plays an important role in the development of diabetic angiopathies.
26641207 There was no significant difference in serum EDN1 between patients with vasovagal syncope, epilepsy, and controls.
26638464 Endothelin-1 is a circulating marker of early atherosclerosis.
26617785 Congenital heart disease complicated with pulmonary artery hypertension is associated with increased circulating endothelial cell counts and ET-1 production.
26599223 Therefore, despite a clear age-specific role in the regulation of vascular tone, endogenous ET-1, acting through endothelin type A receptors, does not account for the age-related reduction in mean shear rate in the common femoral artery.
26573609 A(8002)G intronic polymorphism of pre-pro-endothelin-1 gene is associated with elevated endothelin-1 levels among Tunisian coronary patients.
More...

AA Sequence

MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLD      1 - 70
IIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWN     71 - 140
NHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGKPSRERYVTHNRA    141 - 210
HW                                                                        211 - 212
//

Text Mined References (711)

PMID Year Title
26952167 2016 Endothelin-1 supports clonal derivation and expansion of cardiovascular progenitors derived from human embryonic stem cells.
26923419 2016 Relationship of urinary endothelin-1 with estimated glomerular filtration rate in autosomal dominant polycystic kidney disease: a pilot cross-sectional analysis.
26823880 2015 Homocysteine, endothelin-1 and nitric oxide in patients with hypertensive disorders complicating pregnancy.
26752193 2016 Endothelin-1 Predicts Hemodynamically Assessed Pulmonary Arterial Hypertension in HIV Infection.
26710051 2016 Endothelin-1 Expression Associated with Lipid Peroxidation and Nuclear Factor-?B Activation in Type 2 Diabetes Mellitus Patients with Angiopathy and Limb Amputation.
26641207 2016 Assessment of endothelin and copeptin as biomarkers for vasovagal syncope.
26638464 2014 [PATIENTS WITH HAVE A LEVEL OF ENDOTHELIN-1 AN ANTIFOSFOLIPID SYNDROME: CONNECTION IS WITH MOTION OF DISEASE, DISFUNCTION OF ENDOTHELIA AND ATHEROSCLEROSIS].
26617785 2015 Correlation between congenital heart disease complicated with pulmonary artery hypertension and circulating endothelial cells as well as endothelin-1.
26599223 2016 Endogenous endothelin-1 and femoral artery shear rate: impact of age and implications for atherosclerosis.
26573609 2015 Relationship between the A(8002)G intronic polymorphism of pre-pro-endothelin-1 gene and the endothelin-1 concentration among Tunisian coronary patients.
More...