Property Summary

NCBI Gene PubMed Count 35
Grant Count 22
R01 Count 5
Funding $2,410,877.92
PubMed Score 117.10
PubTator Score 103.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
25530340 enhanced expression of HMGN2 in osteosarcoma cells by HMGN2 lentivirus, exerts inhibitory effects on growth and migration of osteosarcoma cells.
25156469 Data show that chronic lymphocytic leukemia (CLL) cells present high-mobility group nucleosome-binding protein 2 (HMGN2) at membrane.
25060707 HMGN2 is an anti-tumor effector molecule of CD8 T cells.
24872413 HMGN2 is modified by covalent attachment of small ubiquitin-related modifier 1 (SUMO1) by pro-inflammatory signal and identified the major SUMOylated lysine residues that localize to the HMGN2 nucleosome-binding domain at Lys-17 and Lys-35.
22267324 HMGN2 is a bona fide Aurora B substrate in vivo and show that its dynamic association to chromatin is controlled by Aurora B.
21816901 The association of the PRLr with HMGN2 enables Stat5a-responsive promoter binding, thus facilitating transcriptional activation and promoting anchorage-independent growth.
21730181 HMGN2 binds to both the acidic patch in the histone H2A-H2B dimer and to nucleosomal DNA near the entry/exit point, "stapling" the histone core and the DNA.
21518253 HMGN2 acts as a positive modulator of nuclear factor kappaB signalling to promote lipopolysaccharide-induced beta-defensin-2 expression.
20842856 HMGN2 protein has antimicrobial activity and is probably involved in innate immunity in vivo.
20016921 Using acetylated HIV-1 IN as bait in yeast two-hybrid screening identifies transcription regulatory and chromatin remodeling factors LEDGF/p75, KAP1, BTF3b, THRAP3, and HMGN2 as IN-binding partners
More...

AA Sequence

MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPA      1 - 70
ENGDAKTDQAQKAEGAGDAK                                                       71 - 90
//

Text Mined References (39)

PMID Year Title
25530340 2015 Nucleosome-binding protein HMGN2 exhibits antitumor activity in human SaO2 and U2-OS osteosarcoma cell lines.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25156469 2015 Surface localization of high-mobility group nucleosome-binding protein 2 on leukemic B cells from patients with chronic lymphocytic leukemia is related to secondary autoimmune hemolytic anemia.
25060707 2014 HMGN2, a new anti-tumor effector molecule of CD8? T cells.
24872413 2014 High mobility group nucleosomal binding domain 2 (HMGN2) SUMOylation by the SUMO E3 ligase PIAS1 decreases the binding affinity to nucleosome core particles.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22267324 2012 Development of a chemical genetic approach for human aurora B kinase identifies novel substrates of the chromosomal passenger complex.
21816901 2011 HMGN2 inducibly binds a novel transactivation domain in nuclear PRLr to coordinate Stat5a-mediated transcription.
21730181 2011 Architecture of the high mobility group nucleosomal protein 2-nucleosome complex as revealed by methyl-based NMR.
21518253 2011 The chromosomal protein HMGN2 mediates lipopolysaccharide-induced expression of ?-defensins in A549 cells.
More...