Property Summary

NCBI Gene PubMed Count 39
PubMed Score 118.37
PubTator Score 103.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (19)

AA Sequence

MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPA      1 - 70
ENGDAKTDQAQKAEGAGDAK                                                       71 - 90
//

Text Mined References (44)

PMID Year Title