Property Summary

NCBI Gene PubMed Count 38
PubMed Score 58.91
PubTator Score 55.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Propionic acidemia 16 7.941 4.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Atherosclerosis 291 0.0 3.0
Disease Target Count Z-score Confidence
Methylmalonic acidemia 37 3.083 1.5

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 1.200 4.8e-13
lung adenocarcinoma 1.152 1.4e-06
lung cancer 1.800 3.0e-04
lung carcinoma 1.600 1.5e-31
Multiple myeloma 1.236 3.9e-03
non primary Sjogren syndrome sicca 1.300 1.2e-02
non-small cell lung cancer 1.396 4.4e-17
ovarian cancer 1.500 7.6e-04
pancreatic ductal adenocarcinoma liver m... -1.744 8.4e-04

 OMIM Phenotype (1)

 MGI Phenotype (1)

Protein-protein Interaction (4)

Gene RIF (16)

AA Sequence

MAAALRVAAVGARLSVLASGLRAAVRSLCSQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERI      1 - 70
SLLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQK     71 - 140
ICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPAL    141 - 210
TDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTTMSGVAHRAFENDVDALCNLRDFFNYLPL    211 - 280
SSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGR    281 - 350
TVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFA    351 - 420
EATVPKVTVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKF    421 - 490
ANPFPAAVRGFVDDIIQPSSTRARICCDLDVLASKKVQRPWRKHANIPL                         491 - 539
//

Text Mined References (43)

PMID Year Title