Property Summary

NCBI Gene PubMed Count 68
PubMed Score 150.75
PubTator Score 146.48

Knowledge Summary

Patent

No data available

Synonym

Accession P05160 A8K3E5 Q5VYL5
Symbols FXIIIB

Gene

Gene RIF (38)

PMID Text
26159793 Genetic markers associated with low FXIIIB levels increase risk of ischemic stroke cardioembolic subtype.
26088309 Changes in plasma levels of FXIIIB are associated with cognitive decline in the elderly.
25569091 The FXIII-B intron K nt29756 G allele was associated with significant protection against CAS and MI in patients with a fibrinogen level in the upper tertile.
24503678 Here, we update the knowledge about the pathophysiology of factor XIII deficiency and its therapeutic options. [review]
24476525 Data suggest that Factor XIII (composed of subunits F13A and F13B) increases rigidity/strength of fibrin clot, protects fibrin clot against shear stress in circulation, and protects fibrin from prompt elimination by fibrinolytic system. [REVIEW]
23407795 Case Report: congenital FXIII-B deficiency in which alloantibodies developed to exogenous FXIII-B.
22398040 Factor XIII levels are decreased in Crohn's disease patients, but did not correlate with the time course of disease evolution, CRP, serum fibrin levels, platelet count, disease distribution within the bowel, or the presence of a fistulising form.
22329719 Letter: suggest that recurrent pregnancy loss in the general population is not associated with reduced FXIII plasma levels.
21640452 A review analyzes and present an exhaustive amount of F13B mutational data from the past three decades.
21044367 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRLKNLTFIIILIISGELYAEEKPCGFPHVENGRIAQYYYTFKSFYFPMSIDKKLSFFCLAGYTTESGRQ      1 - 70
EEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMRYGCASGYKTTGGKDEEVVQCLSDGW     71 - 140
SSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEVECLTYGWSLTPKCTK    141 - 210
LKCSSLRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLP    211 - 280
INSKIQTHSTTYRHGEIVHIECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLH    281 - 350
SKIYYNGDKVTYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVMNGAVADGILASYATGSS    351 - 420
VEYRCNEYYLLRGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEMKWKYEGKVLHGDLIDFVCKQGY    421 - 490
DLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGVIISSTVDTYENGSSVEYRCFDHHFLE    491 - 560
GSREAYCLDGMWTTPPLCLEPCTLSFTEMEKNNLLLKWDFDNRPHILHGEYIEFICRGDTYPAELYITGS    561 - 630
ILRMQCDRGQLKYPRCIPRQSTLSYQEPLRT                                           631 - 661
//

Text Mined References (74)

PMID Year Title
26247044 2015 Structural and functional influences of coagulation factor XIII subunit B heterozygous missense mutants.
26159793 2015 Genetic Factors Influencing Coagulation Factor XIII B-Subunit Contribute to Risk of Ischemic Stroke.
26088309 2015 High Levels of Antifibrinolytic Proteins Are Found in Plasma of Older Octogenarians With Cardiovascular Disease and Cognitive Decline.
25569091 2015 Factor XIII B subunit polymorphisms and the risk of coronary artery disease.
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
24503678 2014 Coagulation factor XIII deficiency. Diagnosis, prevalence and management of inherited and acquired forms.
24476525 2014 Factor XIII: congenital deficiency factor XIII, acquired deficiency, factor XIII A-subunit, and factor XIII B-subunit.
23407795 2013 Alloantibodies against the B subunit of plasma factor XIII developed in its congenital deficiency.
22704111 2012 Pilot genome-wide association search identifies potential loci for risk of erectile dysfunction in type 1 diabetes using the DCCT/EDIC study cohort.
22398040 2012 The usefulness of factor XIII levels in Crohn's disease.
More...