Property Summary

NCBI Gene PubMed Count 26
Grant Count 34
R01 Count 26
Funding $4,915,830.51
PubMed Score 139.13
PubTator Score 53.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.354 0.005
osteosarcoma 1.605 0.000
astrocytoma 1.300 0.008
glioblastoma 1.300 0.003
breast carcinoma 1.400 0.002
Multiple Sclerosis 1.300 0.001
lung adenocarcinoma 1.377 0.000
ovarian cancer 2.100 0.000

Gene RIF (8)

PMID Text
23166591 Expression of HIV-1 Tat upregulates the abundance of ribophorin I (RPN1) in the nucleoli of Jurkat T-cells
23125841 Expression of HIV-1 Tat upregulates the abundance of ribophorin I (RPN1) in the nucleoli of Jurkat T-cells
23125841 Expression of HIV-1 Tat upregulates the abundance of ribophorin I (RPN1) in the nucleoli of Jurkat T-cells
23125841 Expression of HIV-1 Tat upregulates the abundance of ribophorin I (RPN1) in the nucleoli of Jurkat T-cells
23125841 Expression of HIV-1 Tat upregulates the abundance of ribophorin I (RPN1) in the nucleoli of Jurkat T-cells
22988243 Data indicate that malectin functions by forming a complex with ribophorin I.
19064571 Observational study of gene-disease association. (HuGE Navigator)
18607003 ribophorin I can regulate the delivery of precursor proteins to the OST complex by capturing substrates and presenting them to the catalytic core.

AA Sequence

MEAPAAGLFLLLLLGTWAPAPGSASSEAPPLINEDVKRTVDLSSHLAKVTAEVVLAHLGGGSTSRATSFL      1 - 70
LALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFFTVKLPVALDPGAKISVIVETVYTHVLH     71 - 140
PYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPTRSEDLLDYGPFRDVPAYS    141 - 210
QDTFKVHYENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSF    211 - 280
KTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYA    281 - 350
LKMRFVDHVFDEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQH    351 - 420
IQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRI    421 - 490
GLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKALTSEIALLQSRLKTEGSDLCDRVSEMQKLDAQVKE    491 - 560
LVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKIDHILDAL                           561 - 607
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23314186 2013 Genetic variation associated with circulating monocyte count in the eMERGE Network.
22988243 2012 Malectin forms a complex with ribophorin I for enhanced association with misfolded glycoproteins.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22016385 2011 Selenoprotein K binds multiprotein complexes and is involved in the regulation of endoplasmic reticulum homeostasis.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
More...