Property Summary

NCBI Gene PubMed Count 27
PubMed Score 146.53
PubTator Score 53.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 2.5e-11
ovarian cancer 8520 8.6e-05
osteosarcoma 7950 2.7e-04
Multiple Sclerosis 540 5.0e-04
breast carcinoma 1638 2.3e-03
glioblastoma 5792 2.6e-03
Multiple myeloma 1332 4.5e-03
astrocytoma 1146 8.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.300 8.4e-03
breast carcinoma 1.400 2.3e-03
glioblastoma 1.300 2.6e-03
lung adenocarcinoma 1.100 2.5e-11
Multiple myeloma 1.354 4.5e-03
Multiple Sclerosis 1.300 5.0e-04
osteosarcoma 1.605 2.7e-04
ovarian cancer 2.100 8.6e-05

Gene RIF (6)

AA Sequence

MEAPAAGLFLLLLLGTWAPAPGSASSEAPPLINEDVKRTVDLSSHLAKVTAEVVLAHLGGGSTSRATSFL      1 - 70
LALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFFTVKLPVALDPGAKISVIVETVYTHVLH     71 - 140
PYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPTRSEDLLDYGPFRDVPAYS    141 - 210
QDTFKVHYENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSF    211 - 280
KTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYA    281 - 350
LKMRFVDHVFDEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQH    351 - 420
IQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRI    421 - 490
GLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKALTSEIALLQSRLKTEGSDLCDRVSEMQKLDAQVKE    491 - 560
LVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKIDHILDAL                           561 - 607
//

Text Mined References (37)

PMID Year Title