Property Summary

NCBI Gene PubMed Count 52
Grant Count 20
R01 Count 18
Funding $2,231,018.81
PubMed Score 101.42
PubTator Score 126.97

Knowledge Summary

Patent

No data available

Expression

Gene RIF (28)

PMID Text
26392304 PRM2 gene expression was significantly decreased in immature sperm extracted from the fertile and infertile groups. Caspase 9 activity was significantly increased in immature sperm extracted from both groups.
25649960 The expressed human protamine2 in two fast-growing cell systems, E. coli and HeLa cells. The protamine2 expression significantly attenuated cell proliferation when compared with control cells.
25536093 the quantity of PRM1, PRM2, and TNP2 transcripts and the PRM1/PRM2 mRNA ratio affect spermiogenesis, sperm morphology
23271023 Data indicate changed ecpression levels of PRM2, HSP90 and WNT5A in male of couples experiencing idiopathic recurrent miscarriages.
22472940 significant correlation has been found between protamine 1 and 2 transcripts/proteins and: sperm concentration, progressive sperm motility, sperm fertilization ability as well as embryo quality
22104739 Single nuclotide polymorphisms in PRM2 gene is associated with male infertility.
21317160 Data suggest that Casp4, Casp 6 and TNFSF10 are differentially expressed in potentially fertile and subfertile men and represent useful biomarkers for predicting male fertility in combination with P1 and P2.
21029114 identified and we report for the first time five novel rare haplotypes encompassing the protamine 1 and 2 genes
20378615 Observational study of gene-disease association. (HuGE Navigator)
19863670 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQ      1 - 70
HRSCRRRKRRSCRHRRRHRRGCRTRKRTCRRH                                           71 - 102
//

Text Mined References (54)

PMID Year Title
26392304 2016 The Role of Protamine 2 Gene Expression and Caspase 9 Activity in Male Infertility.
25649960 2015 Expression of sperm-specific protamines impairs bacterial and eukaryotic cell proliferation.
25536093 2015 Quantification of sperm specific mRNA transcripts (PRM1, PRM2, and TNP2) in teratozoospermia and normozoospermia: New correlations between mRNA content and morphology of sperm.
23568457 2013 Genetic variants associated with disordered eating.
23271023 2012 Expression pattern of PRM2, HSP90 and WNT5A in male partners of couples experiencing idiopathic recurrent miscarriages.
22472940 2012 Impact of protamine transcripts and their proteins on the quality and fertilization ability of sperm and the development of preimplantation embryos.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
22104739 2012 Protamine-1 and -2 polymorphisms and gene expression in male infertility: an Italian study.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21317160 2011 Apoptotic gene expression in potentially fertile and subfertile men.
More...