Property Summary

NCBI Gene PubMed Count 53
PubMed Score 103.48
PubTator Score 126.97

Knowledge Summary

Patent

No data available

Expression

Gene RIF (28)

AA Sequence

MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQ      1 - 70
HRSCRRRKRRSCRHRRRHRRGCRTRKRTCRRH                                           71 - 102
//

Text Mined References (55)

PMID Year Title