Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Synonym

Accession P04432
Symbols O2
IGKV1D39

Gene

AA Sequence

MDMRVPAQLLGLLLLWLRGARCDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLI      1 - 70
YAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTP                            71 - 117
//

Text Mined References (9)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11549845 2001 Nomenclature of the human immunoglobulin kappa (IGK) genes.
11298326 2001 Evolutionary dynamics of the human immunoglobulin kappa locus and the germline repertoire of the Vkappa genes.
7926831 1994 Phage display of a human antibody against Clostridium tetani toxin.
6091049 1984 Immunoglobulin genes of the kappa light chain type from two human lymphoid cell lines are closely related.
1907917 1991 The human immunoglobulin kappa locus. Characterization of the duplicated O regions.