Property Summary

NCBI Gene PubMed Count 160
PubMed Score 336.56
PubTator Score 1285.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Lecithin Cholesterol Acyltransferase Deficiency 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Norum disease 2 0.0 5.0

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 2.000 5.4e-04
Astrocytoma, Pilocytic 1.500 1.8e-03
ependymoma 2.400 1.5e-02
glioblastoma multiforme 1.100 3.5e-16
non-small cell lung cancer -1.627 8.6e-23
oligodendroglioma 3.200 3.3e-04
ovarian cancer -1.300 2.6e-11
pancreatic ductal adenocarcinoma liver m... -1.957 2.2e-03

Gene RIF (107)

AA Sequence

MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVILVPGCLGNQLEAKLDKPDVV      1 - 70
NWMCYRKTEDFFTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSSK     71 - 140
LAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLH    141 - 210
LLYFLLRQPQAWKDRFIDGFISLGAPWGGSIKPMLVLASGDNQGIPIMSSIKLKEEQRITTTSPWMFPSR    211 - 280
MAWPEDHVFISTPSFNYTGRDFQRFFADLHFEEGWYMWLQSRDLLAGLPAPGVEVYCLYGVGLPTPRTYI    281 - 350
YDHGFPYTDPVGVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTLEHINAILLG    351 - 420
AYRQGPPASPTASPEPPPPE                                                      421 - 440
//

Text Mined References (174)

PMID Year Title