Property Summary

NCBI Gene PubMed Count 157
Grant Count 214
R01 Count 119
Funding $35,007,211.48
PubMed Score 329.99
PubTator Score 1285.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession P04180 Q53XQ3
Symbols

Gene

PDB

4X96   4XWG   4XX1   5BV7  

Gene RIF (105)

PMID Text
26232163 Report slightly reduction in LCAT that would probably reflect a delay in reverse cholesterol transport occurring in MetS.
26195816 Mapping the naturally occurring mutations onto the structure provides insight into how they may affect LCAT enzymatic activity.
26117245 rs5923 polymorphism is not associated with low high-density lipoprotein cholesterol(HDL-C)levels in Iranian population
26073399 The data indicate that this novel apoA-I missense is associated with markedly decreased levels of HDL cholesterol and very large alpha-1 HDL, as well as decreased serum cellular cholesterol efflux and LCAT activity
25964513 increased cholesterol esterification by LCAT is atheroprotective
25948084 This study investigated how the natural LCAT[T147I] and LCAT[P274S] mutations affect the pathway of biogenesis of high-density lipoproteins.
25589508 A robust all-atom model for LCAT generated by homology modeling
25110219 genetic polymorphism is associated with coronary artery disease in Egyptians
24842300 Cosyntropin testing in an unselected subgroup of 8 ABCA1 mutation carriers and 3 LCAT mutation carriers did not reveal differences between carriers and controls.
24789697 A synonymous H287H mutation in the coding region of exon 6 of the lecithin cholesterol acyltransferase gene was observed in an individual with HDLC levels of 75 mg/dl.
More...

AA Sequence

MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVILVPGCLGNQLEAKLDKPDVV      1 - 70
NWMCYRKTEDFFTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSSK     71 - 140
LAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLH    141 - 210
LLYFLLRQPQAWKDRFIDGFISLGAPWGGSIKPMLVLASGDNQGIPIMSSIKLKEEQRITTTSPWMFPSR    211 - 280
MAWPEDHVFISTPSFNYTGRDFQRFFADLHFEEGWYMWLQSRDLLAGLPAPGVEVYCLYGVGLPTPRTYI    281 - 350
YDHGFPYTDPVGVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTLEHINAILLG    351 - 420
AYRQGPPASPTASPEPPPPE                                                      421 - 440
//

Text Mined References (171)

PMID Year Title
26232163 2015 Increased cholesterol efflux capacity in metabolic syndrome: Relation with qualitative alterations in HDL and LCAT.
26195816 2015 The high-resolution crystal structure of human LCAT.
26117245 2015 Association of Lecithin Cholesterol Acyltransferase rs5923 Polymorphism in Iranian Individuals with Extremely Low High-Density Lipoprotein Cholesterol: Tehran Lipid and Glucose Study.
26073399 Case report: A novel apolipoprotein A-I missense mutation apoA-I (Arg149Ser)Boston associated with decreased lecithin-cholesterol acyltransferase activation and cellular cholesterol efflux.
25964513 2015 Increased plasma cholesterol esterification by LCAT reduces diet-induced atherosclerosis in SR-BI knockout mice.
25948084 2015 The Effect of Natural LCAT Mutations on the Biogenesis of HDL.
25727495 2015 Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
25589508 2015 A robust all-atom model for LCAT generated by homology modeling.
25110219 Increased risk of premature coronary artery disease in Egyptians with ABCA1 (R219K), CETP (TaqIB), and LCAT (4886C/T) genes polymorphism.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
More...