Property Summary

NCBI Gene PubMed Count 24
Grant Count 120
R01 Count 77
Funding $13,366,629.01
PubMed Score 553.26
PubTator Score 175.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P04118 Q5T9G7 Q5U809
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (10)

PMID Text
23918603 Low CLPS expression is associated with pancreatic cancer.
23204298 humans with the Arg92Cys substitution will secrete less functional colipase
20054203 found no evidence for an association of pancreatic colipase(CLPS) single nucleotide polymorphisms rs2766597, rs41270082, rs3748050, and rs3748051 with obesity or percentage of dietary fat intake
20054203 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18726866 CLPS genetic variability associates with insulin secretory function in non-diabetic humans and may represent a novel candidate gene for development of type 2 diabetes
18726866 Observational study of gene-disease association. (HuGE Navigator)
18051367 HIV-1 NC upregulates pancreatic colipase in HEK 293T cells
17715423 Our findings demonstrate that the Arg92Cys polymorphism decreases the function of Cys92 colipase. This change may contribute to the development of type 2 diabetes.
16189801 Observational study of gene-disease association. (HuGE Navigator)
16189801 evidence in two German Caucasian study populations that the variant of the rare colipase Arg109Cys polymorphism might contribute to increased susceptibility of type 2 diabetes

AA Sequence

MEKILILLLVALSVAYAAPGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKT      1 - 70
LYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ                                 71 - 112
//

Text Mined References (25)

PMID Year Title
23918603 2013 Integration of metabolomics and transcriptomics revealed a fatty acid network exerting growth inhibitory effects in human pancreatic cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23204298 2013 The Arg92Cys colipase polymorphism impairs function and secretion by increasing protein misfolding.
20054203 2009 Procolipase gene: no association with early-onset obesity or fat intake.
18726866 2009 Genetic variability of procolipase associates with altered insulin secretion in non-diabetic Caucasians.
17715423 2007 A polymorphism in the gene encoding procolipase produces a colipase, Arg92Cys, with decreased function against long-chain triglycerides.
16189801 2005 Putative association between a new polymorphism in exon 3 (Arg109Cys) of the pancreatic colipase gene and type 2 diabetes mellitus in two independent Caucasian study populations.
15583024 2004 Overview of steroidogenic enzymes in the pathway from cholesterol to active steroid hormones.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...