Property Summary

NCBI Gene PubMed Count 24
PubMed Score 573.51
PubTator Score 175.70

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MEKILILLLVALSVAYAAPGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKT      1 - 70
LYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ                                 71 - 112
//

Text Mined References (25)

PMID Year Title