Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.28

Knowledge Summary

Patent (851)

TINX Plot

  Disease Relevance (3)

Synonym

Accession P04001
Symbols GOP

Gene

PANTHER Protein Class (2)

PDB

1KPW  

Gene RIF (1)

PMID Text
19493002 Immunoreactivity to anti-OPN1LW antibodies was seen in the basal layer of human epidermis & reconstructed skin. The opsin mRNA was seen in total RNA from human skin. Neither immunoreactivity nor mRNA expression was seen in cultured human keratinocytes.

AA Sequence

MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWMIFVVIASVFT      1 - 70
NGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFVLGHPMCVLEGYTVSLCGITG     71 - 140
LWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSG    141 - 210
SSYPGVQSYMIVLMVTCCITPLSIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFC    211 - 280
WGPYAFFACFAAANPGYPFHPLMAALPAFFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSA    281 - 350
SKTEVSSVSSVSPA                                                            351 - 364
//

Text Mined References (12)

PMID Year Title
22888021 2012 G protein-coupled receptors participate in cytokinesis.
20579627 2010 X-linked cone dystrophy caused by mutation of the red and green cone opsins.
19493002 2009 Expressions of rod and cone photoreceptor-like proteins in human epidermis.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
15772651 2005 The DNA sequence of the human X chromosome.
12051694 2002 Novel missense mutations in red/green opsin genes in congenital color-vision deficiencies.
10319869 1999 Position of a 'green-red' hybrid gene in the visual pigment array determines colour-vision phenotype.
8666378 1995 Gene conversion between red and defective green opsin gene in blue cone monochromacy.
8185948 1994 Molecular determinants of human red/green color discrimination.
3303660 1986 Molecular biology of the visual pigments.
More...