Property Summary

NCBI Gene PubMed Count 30
PubMed Score 8.41
PubTator Score 65.12

Knowledge Summary

Patent (851)

Gene RIF (16)

AA Sequence

MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWMIFVVIASVFT      1 - 70
NGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFVLGHPMCVLEGYTVSLCGITG     71 - 140
LWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSG    141 - 210
SSYPGVQSYMIVLMVTCCITPLSIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFC    211 - 280
WGPYAFFACFAAANPGYPFHPLMAALPAFFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSA    281 - 350
SKTEVSSVSSVSPA                                                            351 - 364
//

Text Mined References (32)

PMID Year Title