Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MRWALLVLLAFLSPASQKSSNLEGRTKSVTRQTGSSAEITCDLTVTNTFYIHWYLHQEGKAPQRLLYYDV      1 - 70
STARDVLESGLSPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWDR                           71 - 118
//

Text Mined References (7)

PMID Year Title
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
3458221 1986 Cloning and sequence analysis of complementary DNA encoding an aberrantly rearranged human T-cell gamma chain.
3453106 1986 Human T-cell gamma genes contain N segments and have marked junctional variability.
2969332 1988 Variable region genes in the human T-cell rearranging gamma (TRG) locus: V-J junction and homology with the mouse genes.
2938743 1986 Diversity and rearrangement of the human T cell rearranging gamma genes: nine germ-line variable genes belonging to two subgroups.
2527426 1989 The human T-cell receptor gamma (TRG) genes.