Property Summary

NCBI Gene PubMed Count 43
PubMed Score 0.00
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -2.303 0.000
chronic lymphosyte leukemia 1.300 0.000
periodontitis 1.300 0.000
interstitial cystitis 2.000 0.005
sonic hedgehog group medulloblastoma 2.400 0.000
primary Sjogren syndrome 1.400 0.005
lung adenocarcinoma 1.200 0.009
nasopharyngeal carcinoma -1.700 0.002
Breast cancer 2.500 0.019
ovarian cancer -1.500 0.000

Synonym

Accession P01857
Symbols

Gene

PDB

3BN9   3BE1   3WJL   3WJJ   4N0U   3EYQ   2QR0   3BDY   1AQK   2JB5   2JB6   3TV3   3TWC   3TYG   4EOW   4LLD   4LLM   4LLQ   5IQ7   5IQ9   3DVG   3DVN   3B2U   3B2V   3C09   1D5B   1D5I   1D6V   1DFB   1GAF   1HKL   1HZH   1I7Z   1OP3   2O5X   2O5Y   2O5Z   2QQK   2QQL   2QQN   2R56   2VXQ   3BKY   3BQU   3C08   3CFJ   3CFK   3CSY   3D0L   3D85   3EYF   3EYO   3O11   3U0W   3U7W   3U7Y   4D9R   1AJ7   1BEY   1DN2   1E4K   1FC1   1FC2   1FCC   1H3T   1H3U   1H3V   1H3W   1H3X   1H3Y   1L6X   1N7M   1OQO   1OQX   1T83   1T89   1VGE   2DTS   2GJ7   2I5Y   2IWG   2J6E   2OSL   2QAD   2QL1   2RCJ   2RCS   2WAH   3AGV   3AVE   3AY4   3C2S   3D0V   3D6G   3DJ9   3DNK   3DO3   3DRO   3DRQ   3FJT   3RY6   3S7G   3SGJ   3SGK   3V7M   3V8C   3V95   3WKN   3WN5   4ACP   4B7I   4BM7   4BSV   4BSW   4BYH   4CDH   4D9Q   4DAG   4DZ8   4J12   4KU1   4NQS   4NQT   4NQU   4NWT   4NWU   4O4Y   4O51   4Q6Y   4Q74   4Q7D   4W4N   4W4O   4WI2   4WI3   4WI4   4WI5   4WI6   4WI7   4WI8   4WI9   4X4M   4X98   4X99   4ZNE   5BW7   5D4Q   5D6D   5DI8   5DJ0   5DJ2   5DJ6   5DJ8   5DJA   5DJC   5DJD   5DJX   5DJY   5DJZ   5DK0   5DK2   5DVK   5DVL   5DVM   5DVN   5DVO   5HSF  

Gene RIF (19)

PMID Text
25940394 Using these maps as a constraint, we derived 120 conformations of the antibody via structural flexible docking of the crystal structure to these maps by targeted molecular dynamics simulations.
25358868 Down-regulation of IGHG1 expression may be related to the etiology of poor sleep quality and chronic abdominal pain.
24662005 These results show distinct epistatic contributions of GM and FcgammaRIIIa alleles to the antibody-dependent cell-mediated cytotoxicity of neuroblastoma cells
24304136 Data indicate the involvement of immunoglobulin allotypes immunoglobulin gamma and kappa chains in immunity to a cancer-testis antigen, which has important implications for XAGE-1b-based immunotherapeutic interventions in lung adenocarcinoma.
23117283 Suppression of IGHG1 gene expression by siRNA leads to growth inhibition and apoptosis induction in human prostate cancer cell.
21654544 The presence of IGHG1 in pancreatic cancer cells might constitute an important element responsible for tumor cell proliferation and immune evasion mechanisms.
19542624 Immunoglobulin (Ig) GM genes - genetic markers of IgG heavy chains located on chromosome 14 - are functional risk and protective factors for AD.
19319024 The IGHG1 polymorphism does not seem to play a major role in the induction of antibodies-to-infliximab.
19319024 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19317746 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT      1 - 70
VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP     71 - 140
EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA    141 - 210
LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV    211 - 280
LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK                        281 - 330
//

Text Mined References (51)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25940394 2015 3D Structural Fluctuation of IgG1 Antibody Revealed by Individual Particle Electron Tomography.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
25358868 2014 Sleep quality, BDNF genotype and gene expression in individuals with chronic abdominal pain.
24662005 2014 Immunoglobulin GM and Fc?RIIIa genotypes influence cytotoxicity of neuroblastoma cells.
24304136 2014 Genetic variants of immunoglobulin ? and ? chains influence humoral immunity to the cancer-testis antigen XAGE-1b (GAGED2a) in patients with non-small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...