Property Summary

NCBI Gene PubMed Count 45
PubMed Score 0.00
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer 2.500 1.9e-02
chronic lymphosyte leukemia 1.300 8.3e-06
interstitial cystitis 2.000 4.8e-03
lung adenocarcinoma 1.200 8.6e-03
nasopharyngeal carcinoma -1.700 2.2e-03
osteosarcoma -2.303 8.2e-10
ovarian cancer -1.500 1.0e-11
periodontitis 1.300 3.5e-23
primary Sjogren syndrome 1.400 5.2e-03
sonic hedgehog group medulloblastoma 2.400 4.8e-04

Synonym

Accession P01857
Symbols

Gene

PDB

3BN9   3BE1   5K33   5KWG   3WJL   3WJJ   4N0U   3EYQ   2QR0   3BDY   3DVG   3DVN   3B2U   3B2V   3C09   5M3V   1D5B   1D5I   1D6V   1DFB   1GAF   1HKL   1HZH   1I7Z   1OP3   2O5X   2O5Y   2O5Z   2QQK   2QQL   2QQN   2R56   2VXQ   3BKY   3BQU   3C08   3CFJ   3CFK   3CSY   3D0L   3D85   3EYF   3EYO   3O11   3U0W   3U7W   3U7Y   4D9R   4HIX   4XMP   4XNY   4XNZ   4XXD   1AJ7   1AQK   1AXS   1BEY   1DN2   1E4K   1FC1   1FC2   1FCC   1H3T   1H3U   1H3V   1H3W   1H3X   1H3Y   1L6X   1N7M   1OQO   1OQX   1PG7   1T83   1T89   1VGE   2DTS   2GJ7   2I5Y   2IWG   2J6E   2JB5   2JB6   2OSL   2QAD   2QL1   2RCJ   2RCS   2WAH   3AGV   3AVE   3AY4   3C2S   3D0V   3D6G   3DJ9   3DNK   3DO3   3DRO   3DRQ   3FJT   3MCL   3RY6   3S7G   3SGJ   3SGK   3TV3   3TWC   3TYG   3V7M   3V8C   3V95   3WKN   3WN5   4ACP   4B7I   4BM7   4BSV   4BSW   4BYH   4CDH   4D9Q   4DAG   4DZ8   4EOW   4J12   4KU1   4LLD   4LLM   4LLQ   4NQS   4NQT   4NQU   4NWT   4NWU   4O4Y   4O51   4Q6Y   4Q74   4Q7D   4W4N   4W4O   4WI2   4WI3   4WI4   4WI5   4WI6   4WI7   4WI8   4WI9   4X4M   4X98   4X99   4ZNE   5BW7   5D4Q   5D6D   5DI8   5DJ0   5DJ2   5DJ6   5DJ8   5DJA   5DJC   5DJD   5DJX   5DJY   5DJZ   5DK0   5DK2   5DVK   5DVL   5DVM   5DVN   5DVO   5GSQ   5HSF   5HY9   5HYE   5HYF   5HYI   5IQ7   5IQ9   5IW3   5IW6   5JIH   5JII   5JIK   5K64   5K65   5K8D   5TPS   5U4Y   5U52   5U66   5V43   5V4E  

Gene RIF (20)

AA Sequence

ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT      1 - 70
VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP     71 - 140
EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA    141 - 210
LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV    211 - 280
LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK                        281 - 330
//

Text Mined References (58)

PMID Year Title