Property Summary

NCBI Gene PubMed Count 45
PubMed Score 0.00
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer 2.500 1.9e-02
chronic lymphosyte leukemia 1.300 8.3e-06
interstitial cystitis 2.000 4.8e-03
lung adenocarcinoma 1.200 8.6e-03
nasopharyngeal carcinoma -1.700 2.2e-03
osteosarcoma -2.303 8.2e-10
ovarian cancer -1.500 1.0e-11
periodontitis 1.300 3.5e-23
primary Sjogren syndrome 1.400 5.2e-03
sonic hedgehog group medulloblastoma 2.400 4.8e-04

PDB (197)

Gene RIF (20)

AA Sequence

ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT      1 - 70
VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP     71 - 140
EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA    141 - 210
LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV    211 - 280
LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK                        281 - 330
//

Text Mined References (58)

PMID Year Title