Property Summary

NCBI Gene PubMed Count 88
PubMed Score 259.44
PubTator Score 173.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Breast cancer -4.900 2.2e-02
breast carcinoma -2.400 5.1e-14
chronic lymphosyte leukemia 2.300 8.9e-12
colon cancer -1.100 3.1e-02
Endometriosis -1.482 1.5e-02
head and neck cancer 1.100 1.4e-02
intraductal papillary-mucinous adenoma (... 1.200 3.7e-02
intraductal papillary-mucinous neoplasm ... 2.000 7.1e-03
invasive ductal carcinoma -3.717 1.9e-05
lung adenocarcinoma -1.800 8.1e-05
lung cancer -3.200 3.2e-06
lung carcinoma -4.400 7.7e-39
nasopharyngeal carcinoma -3.800 2.6e-04
non-small cell lung cancer -2.967 6.1e-09
osteosarcoma 1.339 1.8e-05
ovarian cancer 1.700 1.5e-02
pancreatic cancer 1.600 2.3e-02
primary pancreatic ductal adenocarcinoma 1.597 1.7e-02
urothelial carcinoma -1.400 5.0e-05

Protein-protein Interaction (1)

Gene RIF (47)

AA Sequence

MLLFVLTCLLAVFPAISTKSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISS      1 - 70
EGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQGPGLLNDTKVY     71 - 140
TVDLGRTVTINCPFKTENAQKRKSLYKQIGLYPVLVIDSSGYVNPNYTGRIRLDIQGTGQLLFSVVINQL    141 - 210
RLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCD    211 - 280
VVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEES    281 - 350
TIPRSPTVVKGVAGGSVAVLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPG    351 - 420
NGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSS    421 - 490
YEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYV    491 - 560
AVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVADTRDQADGSRASVDSGSS    561 - 630
EEQGGSSRALVSTLVPLGLVLAVGAVAVGVARARHRKNVDRVSIRSYRTDISMSDFENSREFGANDNMGA    631 - 700
SSITQETSLGGKEEFVATTESTTETKEPKKAKRSSKEEAEMAYKDFLLQSSTVAAEAQDGPQEA          701 - 764
//

Text Mined References (95)

PMID Year Title