Property Summary

NCBI Gene PubMed Count 85
Grant Count 97
R01 Count 55
Funding $9,609,991.52
PubMed Score 245.51
PubTator Score 173.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
urothelial carcinoma -1.400 0.000
osteosarcoma 1.339 0.000
chronic lymphosyte leukemia 2.300 0.000
primary pancreatic ductal adenocarcinoma 1.597 0.017
non-small cell lung cancer -2.967 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.037
intraductal papillary-mucinous neoplasm ... 2.000 0.007
colon cancer -2.400 0.031
lung cancer -3.500 0.000
Breast cancer -5.800 0.000
lung adenocarcinoma -1.800 0.000
invasive ductal carcinoma -3.717 0.000
nasopharyngeal carcinoma -3.800 0.000
Endometriosis -1.482 0.015
lung carcinoma -4.400 0.000
breast carcinoma -2.400 0.000
ovarian cancer 1.700 0.015
pancreatic cancer 1.600 0.023
head and neck cancer 1.100 0.014

Synonym

Accession P01833 Q68D81 Q8IZY7 PIgR
Symbols

Gene

PDB

3CM9   3CHN   1XED   2OCW   5D4K  

Gene RIF (44)

PMID Text
26943617 The polymeric immunoglobulin receptor secretory component structure comprises five immunoglobulin-like domains (D1-D5) arranged as a triangle, with an interface between ligand-binding domains D1 and D5.
26239418 These results demonstrate that SLPI down-regulates pIgR expression through the NF-kappaB signaling pathway by inhibiting degradation of IkappaBbeta protein.
26176052 Positive expression of pIgR was statistically significantly associated with poor prognosis of patients with colon carcinoma hepatic metastasis.
25956706 Crohn disease patients were characterized as having decreased median expression of PIGR, in non-inflamed colonic mucosa. By contrast, Ulcerative colitis patients exhibited decreased expression of PIGR in colon mucosa.
25922073 the polymeric immunoglobulin receptor (pIgR) is highly expressed by renal cyst-lining cells. pIgR expression is, in part, driven by aberrant STAT6 pathway activation.
25455218 In conclusion these data suggest that Streptococcus pneumoniae PspC-promoted uptake via the polymeric immunoglobulin receptor of epithelial cells is mediated by both clathrin and caveolin dependent pathway.
25397670 Reduced expression of the polymeric immunoglobulin receptor in pancreatic and periampullary adenocarcinoma signifies tumour progression and poor prognosis.
25078120 pIgR down-regulation in chronic obstructive pulmonary disease correlates with severity. Bronchial epithelium in vitro retains aberrant imprinting for pIgR expression. pIgR down-regulation is linked to TGF-beta-driven reprogramming of bronchial epithelium.
24699841 Polymeric immunoglobulin receptor expression is correlated with poor prognosis in patients with osteosarcoma.
24694107 High PIGR expression independently predicts a decreased risk of recurrence and an improved survival in patients with adenocarcinoma of the upper gastrointestinal tract
More...

AA Sequence

MLLFVLTCLLAVFPAISTKSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISS      1 - 70
EGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQGPGLLNDTKVY     71 - 140
TVDLGRTVTINCPFKTENAQKRKSLYKQIGLYPVLVIDSSGYVNPNYTGRIRLDIQGTGQLLFSVVINQL    141 - 210
RLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCD    211 - 280
VVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEES    281 - 350
TIPRSPTVVKGVAGGSVAVLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPG    351 - 420
NGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSS    421 - 490
YEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYV    491 - 560
AVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVADTRDQADGSRASVDSGSS    561 - 630
EEQGGSSRALVSTLVPLGLVLAVGAVAVGVARARHRKNVDRVSIRSYRTDISMSDFENSREFGANDNMGA    631 - 700
SSITQETSLGGKEEFVATTESTTETKEPKKAKRSSKEEAEMAYKDFLLQSSTVAAEAQDGPQEA          701 - 764
//

Text Mined References (92)

PMID Year Title
26943617 2016 The structure and dynamics of secretory component and its interactions with polymeric immunoglobulins.
26239418 2015 Secretory leukocyte protease inhibitor inhibits expression of polymeric immunoglobulin receptor via the NF-?B signaling pathway.
26176052 2014 COLORECTAL Polymeric Immunoglobulin Receptor Expression is Correlated with Hepatic Metastasis and Poor Prognosis in Colon Carcinoma Patients with Hepatic Metastasis.
25956706 2015 Correlation of Biomarker Expression in Colonic Mucosa with Disease Phenotype in Crohn's Disease and Ulcerative Colitis.
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25922073 2015 Exploitation of the Polymeric Immunoglobulin Receptor for Antibody Targeting to Renal Cyst Lumens in Polycystic Kidney Disease.
25455218 2014 Endocytosis of Streptococcus pneumoniae via the polymeric immunoglobulin receptor of epithelial cells relies on clathrin and caveolin dependent mechanisms.
25397670 2014 Reduced expression of the polymeric immunoglobulin receptor in pancreatic and periampullary adenocarcinoma signifies tumour progression and poor prognosis.
25078120 2014 Polymeric immunoglobulin receptor down-regulation in chronic obstructive pulmonary disease. Persistence in the cultured epithelium and role of transforming growth factor-?.
More...