Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P01780 A0A0B4J1U8 P01781 P80419
Symbols VH
IGHV37

Gene

PDB

2FL5  

Gene RIF (1)

PMID Text
22902363 Mutated IGHV3-7-encoded rheumatoid factor B-cell receptors are associated with chronic lymphocytic leukemia.

AA Sequence

MELGLSWVFLVAILEGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANI      1 - 70
KQDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR                            71 - 117
//

Text Mined References (12)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22902363 2013 A novel chronic lymphocytic leukemia subset expressing mutated IGHV3-7-encoded rheumatoid factor B-cell receptors that are functionally proficient.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
11340299 2001 Nomenclature of the human immunoglobulin heavy (IGH) genes.
9841928 1998 The complete nucleotide sequence of the human immunoglobulin heavy chain variable region locus.
8490662 1993 Structure and physical map of 64 variable segments in the 3'0.8-megabase region of the human immunoglobulin heavy-chain locus.
7737190 1995 Characterization of the two unique human anti-flavin monoclonal immunoglobulins.
More...