Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P01701 A0A075B6I5 P01702 P06316 P06888
Symbols V1-19
IGLV151

Gene

AA Sequence

MTCSPLLLTLLIHCTGSWAQSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYD      1 - 70
NNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSA                            71 - 117
//

Text Mined References (12)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
11872955 2001 Nomenclature of the human immunoglobulin lambda (IGL) genes.
10591208 1999 The DNA sequence of human chromosome 22.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
8951372 1996 Sequence and evolution of the human germline V lambda repertoire.
6404900 1983 Comparative studies on the structure of the light chains of human immunoglobulins. IV. Assignment of a subsubgroup.
6095199 1984 Molecular cloning of a human immunoglobulin lambda chain variable sequence.
More...