Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

AA Sequence

MAGFPLLLTLLTHCAGSWAQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYS      1 - 70
NNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLSG                            71 - 117
//

Text Mined References (12)

PMID Year Title