Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P01624 A0A0B4J1T9 P04207
Symbols L2
IGKV315

Gene

AA Sequence

MEAPAQLLFLLLLWLPDTTGEIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYG      1 - 70
ASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWP                              71 - 115
//

Text Mined References (9)

PMID Year Title
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11549845 2001 Nomenclature of the human immunoglobulin kappa (IGK) genes.
3083417 1986 Cloning and sequence determination of a human rheumatoid factor light-chain gene.
2492051 1989 Characterization of four homologous L chain variable region genes that are related to 6B6.6 idiotype positive human rheumatoid factor L chains.
60899 The amino acid sequence of the variable regions of the light chains from two idiotypically cross reactive IgM anti-gamma globulins.