Property Summary

NCBI Gene PubMed Count 19
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
chronic lymphosyte leukemia -3.500 3.2e-06
Chronic obstructive pulmonary disease -1.300 3.9e-02
colon cancer -1.700 7.7e-03
cutaneous lupus erythematosus 3.300 2.4e-02
cystic fibrosis and chronic rhinosinusit... 2.055 1.1e-02
esophageal adenocarcinoma 2.000 4.4e-02
interstitial cystitis 3.000 1.4e-02
lung adenocarcinoma 1.283 2.2e-02
lung cancer -1.200 1.0e-03
Multiple myeloma -3.299 3.7e-04
non-small cell lung cancer 1.056 4.8e-03
osteosarcoma -6.528 1.5e-11
pancreatic cancer 2.600 2.5e-04
periodontitis 2.400 1.2e-30
posterior fossa group A ependymoma 1.200 1.1e-02
primary pancreatic ductal adenocarcinoma 2.981 6.8e-04
primary Sjogren syndrome 1.500 4.3e-02
psoriasis -1.500 7.4e-03
tuberculosis 1.400 5.1e-03
ulcerative colitis 4.200 1.2e-07
X-linked agammaglobulinemia -1.512 1.7e-03

Gene RIF (1)

AA Sequence

METPAQLLFLLLLWLPDTTGEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIY      1 - 70
GASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP                             71 - 116
//

Text Mined References (26)

PMID Year Title