Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P01619 A0A0B4J1Z6 P01620 P01621 P01622 P01623 P04206 P06311 P18135 P18136
Symbols A27
13K18
IGKV320

Gene

PDB

1DH5   4LRN   4M62   4M8Q   4OB5   4ODX  

Gene RIF (1)

PMID Text
22051533 some of the entities with stereotyped IGK3-20 BcR described in this study were also positive for serum HCV antibodies

AA Sequence

METPAQLLFLLLLWLPDTTGEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIY      1 - 70
GASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP                             71 - 116
//

Text Mined References (23)

PMID Year Title
23398317 2013 Defective immunoglobulin A (IgA) glycosylation and IgA deposits in patients with IgA nephropathy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23250751 2013 Human plasma-derived polymeric IgA and IgM antibodies associate with secretory component to yield biologically active secretory-like antibodies.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22158414 2011 Molecular programming of B cell memory.
22051533 2012 Antigen receptor stereotypy across B-cell lymphoproliferations: the case of IGHV4-59/IGKV3-20 receptors with rheumatoid factor activity.
20176268 2010 Structure and function of immunoglobulins.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17576170 2007 Immunoglobulin somatic hypermutation.
More...