Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
periodontitis 269 1.23084841229858E-30
osteosarcoma 7933 1.45177678561305E-11
ulcerative colitis 2087 1.2286717652826E-7
chronic lymphosyte leukemia 232 3.19969056251036E-6
lung cancer 4473 5.70478460896761E-6
pancreatic cancer 2300 2.51714209738502E-4
Multiple myeloma 1328 3.73074814539094E-4
primary pancreatic ductal adenocarcinoma 1271 6.83294308926354E-4
interstitial cystitis 2299 8.97204322550135E-4
X-linked agammaglobulinemia 7 0.00172082187335888
non-small cell lung cancer 2798 0.00481088516900643
tuberculosis 1563 0.00509667035149581
psoriasis 6685 0.00739748780501148
colon cancer 1475 0.0077477732851834
cystic fibrosis and chronic rhinosinusitis 213 0.0110212052354454
posterior fossa group A ependymoma 1511 0.0114521918077824
lung adenocarcinoma 2714 0.0219761885673794
cutaneous lupus erythematosus 1056 0.0242955094097722
Chronic obstructive pulmonary disease 147 0.0391214461878457
primary Sjogren syndrome 789 0.0429623869887161
esophageal adenocarcinoma 737 0.0441229167232712

Expression

Synonym

Accession P01619 A0A0B4J1Z6 P01620 P01621 P01622 P01623 P04206 P06311 P18135 P18136
Symbols A27
13K18
IGKV320

Gene

PDB

1DH5   4LRN   4M62   4M8Q   4OB5   4ODX  

Gene RIF (1)

PMID Text
22051533 some of the entities with stereotyped IGK3-20 BcR described in this study were also positive for serum HCV antibodies

AA Sequence

METPAQLLFLLLLWLPDTTGEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIY      1 - 70
GASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP                             71 - 116
//

Text Mined References (23)

PMID Year Title
23398317 2013 Defective immunoglobulin A (IgA) glycosylation and IgA deposits in patients with IgA nephropathy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23250751 2013 Human plasma-derived polymeric IgA and IgM antibodies associate with secretory component to yield biologically active secretory-like antibodies.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22158414 2011 Molecular programming of B cell memory.
22051533 2012 Antigen receptor stereotypy across B-cell lymphoproliferations: the case of IGHV4-59/IGKV3-20 receptors with rheumatoid factor activity.
20176268 2010 Structure and function of immunoglobulins.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17576170 2007 Immunoglobulin somatic hypermutation.
More...