Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

AA Sequence

MDMRVLAQLLGLLLLCFPGARCDIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPEKAPKSLI      1 - 70
YAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYP                            71 - 117
//

Text Mined References (9)

PMID Year Title